CHAC_SCHPO - dbPTM
CHAC_SCHPO - PTM Information in dbPTM
Basic Information of Protein
UniProt ID CHAC_SCHPO
UniProt AC P87305
Protein Name Glutathione-specific gamma-glutamylcyclotransferase {ECO:0000250|UniProtKB:P32656}
Gene Name SPBC31F10.03 {ECO:0000312|PomBase:SPBC31F10.03}
Organism Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length 203
Subcellular Localization Cytoplasm . Nucleus .
Protein Description Gamma-glutamylcyclotransferase acting specifically on glutathione, but not on other gamma-glutamyl peptides. Allows utilization of gluthathione through subsequent cleavage of the Cys-Gly dipeptide by Cys-Gly metallodipeptidase dug1..
Protein Sequence MKTLSPEGSLWVFGYGSLIWHPPPHYDYSIPCFIKGYVRRFWMRSEDHRGTVNSPGLVLTLIPYEEWKQFSDWSFTPFDEGCWGMAFRIPAKYATQVREYLDDREVNGYTAHSVPVYAHTGDEIPVLENCLVYVGTSKSPQFQPSDDLTQMAKIISTRRGKSGDNFVYLFELAKCLRHLSPESKDIHVFELEAEVRKQMQKTR
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of CHAC_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of CHAC_SCHPO !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of CHAC_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of CHAC_SCHPO !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of CHAC_SCHPO !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of CHAC_SCHPO

loading...

Related Literatures of Post-Translational Modification

TOP