UniProt ID | YBLC_SCHPO | |
---|---|---|
UniProt AC | Q9URV0 | |
Protein Name | Uncharacterized RNA-binding protein C106.12c | |
Gene Name | SPBC106.12c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 274 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSLEKSLDEIINERTNGFDHKHSRRRGSQNRISKKSRLTYKFKRASKEHNSSPDDGPWQHDLDQEQDAHPRTTHLQKRQHSENRFGVRVENLHYQVLEKDVLSLFENFHPIRVIMNYDRAGRSEGSCDVYFETSQDAEDAQKTLQSTNLKGSEIQISKKSPPSLFDRISDMPHSARKPSRSSRSNRGFNRSSKKDDRSFRSSSKKSSNNSISHEDLDKELDEYAMSFHAASTVSSHSSQDFTPSIANAHEKNEPVAPSKDSNLTEEMDLQMEAV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MSLEKSLDEIINE --CCHHHHHHHHHHH | 31.51 | 21712547 | |
51 | Phosphorylation | RASKEHNSSPDDGPW HHHHHCCCCCCCCCC | 45.19 | 28889911 | |
52 | Phosphorylation | ASKEHNSSPDDGPWQ HHHHCCCCCCCCCCC | 37.35 | 21712547 | |
160 | Phosphorylation | EIQISKKSPPSLFDR EEEECCCCCCCHHHH | 45.86 | 25720772 | |
174 | Phosphorylation | RISDMPHSARKPSRS HHCCCCCCCCCCCCC | 24.73 | 29996109 | |
210 | Phosphorylation | SKKSSNNSISHEDLD CCCCCCCCCCHHHHH | 29.71 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YBLC_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YBLC_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YBLC_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YBLC_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...