YBLC_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YBLC_SCHPO
• UniProt AC: Q9URV0
• Protein Name: Uncharacterized RNA-binding protein C106.12c
• Gene Name: SPBC106.12c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 274
• Protein Sequence: MSLEKSLDEIINERTNGFDHKHSRRRGSQNRISKKSRLTYKFKRASKEHNSSPDDGPWQHDLDQEQDAHPRTTHLQKRQHSENRFGVRVENLHYQVLEKDVLSLFENFHPIRVIMNYDRAGRSEGSCDVYFETSQDAEDAQKTLQSTNLKGSEIQISKKSPPSLFDRISDMPHSARKPSRSSRSNRGFNRSSKKDDRSFRSSSKKSSNNSISHEDLDKELDEYAMSFHAASTVSSHSSQDFTPSIANAHEKNEPVAPSKDSNLTEEMDLQMEAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MSLEKSLDEIINE --CCHHHHHHHHHHH	31.51	21712547
51	Phosphorylation	RASKEHNSSPDDGPW HHHHHCCCCCCCCCC	45.19	28889911
52	Phosphorylation	ASKEHNSSPDDGPWQ HHHHCCCCCCCCCCC	37.35	21712547
160	Phosphorylation	EIQISKKSPPSLFDR EEEECCCCCCCHHHH	45.86	25720772
174	Phosphorylation	RISDMPHSARKPSRS HHCCCCCCCCCCCCC	24.73	29996109
210	Phosphorylation	SKKSSNNSISHEDLD CCCCCCCCCCHHHHH	29.71	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YBLC_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YBLC_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YBLC_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YBLC_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.