DYL1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DYL1_SCHPO
• UniProt AC: Q9UR05
• Protein Name: Dynein light chain 1, cytoplasmic
• Gene Name: dlc2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 85
• Subcellular Localization: Cytoplasm, cytoskeleton.
• Protein Description: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures (By similarity)..
• Protein Sequence: MAVIKAVDMSEKMQQEAIHAAVQAMEKFTIEKDIAAFIKREFDKKFSPTWHCIVGRNFGSFVTHESRHFIYFYLGTVAFLLFKSG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of DYL1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DYL1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DYL1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DYL1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ELP5_SCHPO	elp5	genetic	18818364
BYR2_SCHPO	byr2	genetic	18818364
RL16B_SCHPO	rpl1601	genetic	18818364
HPC2_SCHPO	hip4	genetic	18818364
AIR1_SCHPO	air1	genetic	18818364
CCR4_SCHPO	ccr4	genetic	18818364
VPH2_SCHPO	vph2	genetic	18818364

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.