UniProt ID | HOP2_SCHPO | |
---|---|---|
UniProt AC | Q9HGK2 | |
Protein Name | Homologous-pairing protein 2 | |
Gene Name | meu13 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 216 | |
Subcellular Localization | Nucleus . | |
Protein Description | Required for proper homologous pairing and efficient cross-over and intragenic recombination during meiosis. Acts indirectly in a process facilitating homologous recombination. Acts during mid-to late-horse-tail period.. | |
Protein Sequence | MAKAKEVKAKPIKGEEAEKLVYEYLRKTNRPYSATDVSANLKNVVSKQVAQKALEQLRDTGLIHGKLYGKQSVFVCLQDDLAAATPEELAEMEKQIQELKDEVSVVKTLYKEKCIELQALNNSLSPAEIREKIQSIDKEIEETSSKLESLRNGTVKQISKEAMQKTDKNYDFAKKGFSNRKKMFYDLWHLITDSLENPKQLWEKLGFETEGPIDLN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of HOP2_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HOP2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HOP2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HOP2_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAD3_SCHPO | rad3 | genetic | 12032093 | |
RAD17_SCHPO | rad17 | genetic | 12032093 | |
CDS1_SCHPO | cds1 | genetic | 12032093 | |
MEK1_SCHPO | mek1 | genetic | 12032093 | |
SPO11_SCHPO | rec12 | genetic | 12482912 | |
MEK1_SCHPO | mek1 | genetic | 12482912 | |
MCP7_SCHPO | mcp7 | physical | 15210864 | |
RAD4_SCHPO | rad4 | genetic | 14718568 | |
PNN1_SCHPO | pnn1 | genetic | 18818364 | |
TIP1_SCHPO | tip1 | genetic | 18818364 | |
DPOD4_SCHPO | cdm1 | genetic | 18818364 | |
RSC4_SCHPO | rsc4 | genetic | 18818364 | |
SGF29_SCHPO | sgf29 | genetic | 18818364 | |
RL16B_SCHPO | rpl1601 | genetic | 18818364 | |
DHSD_SCHPO | sdh4 | genetic | 18818364 | |
MU154_SCHPO | mug154 | genetic | 18818364 | |
ATG18_SCHPO | atg1801 | genetic | 18818364 | |
YQF1_SCHPO | SPCC126.01c | genetic | 18818364 | |
PUS1_SCHPO | pus1 | genetic | 18818364 | |
AAKB_SCHPO | amk2 | genetic | 18818364 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...