UniProt ID | DPOD4_SCHPO | |
---|---|---|
UniProt AC | O59835 | |
Protein Name | DNA polymerase delta subunit 4 | |
Gene Name | cdm1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 160 | |
Subcellular Localization | Nucleus. | |
Protein Description | Appears to have a role in the stabilization of the DNA polymerase delta complex.. | |
Protein Sequence | MKKRTTQAKKSGQNTNIRDVFPHVVRSNSSQSHIGKKVSSEQSPTPDVTITTKTLDERIKEDDELSKEVEEAWNQIMAERISEPIHCENITKVEFILHHFDTTARYGPYLGMTRMQRWKRAKNFNLNPPETVGKILMLEEADEENRKRESLFYDLQTIPG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of DPOD4_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DPOD4_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DPOD4_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DPOD4_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YJ03_SCHPO | rhn1 | genetic | 18818364 | |
ELP4_SCHPO | elp4 | genetic | 18818364 | |
CAF1_SCHPO | caf1 | genetic | 18818364 | |
BYR2_SCHPO | byr2 | genetic | 18818364 | |
PEX1_SCHPO | pex1 | genetic | 22681890 | |
DCN1_SCHPO | SPBC839.03c | genetic | 22681890 | |
YAJ1_SCHPO | gto2 | genetic | 22681890 | |
SKH1_SCHPO | pek1 | genetic | 22681890 | |
YJ03_SCHPO | rhn1 | genetic | 22681890 | |
RS3_SCHPO | rps3 | genetic | 22681890 | |
YGDH_SCHPO | SPBC1773.17c | genetic | 22681890 | |
YFPC_SCHPO | SPAC7D4.12c | genetic | 22681890 | |
RAD1_SCHPO | rad1 | genetic | 22681890 | |
CLR2_SCHPO | clr2 | genetic | 22681890 | |
ATP12_SCHPO | atp12 | genetic | 22681890 | |
SGF73_SCHPO | sgf73 | genetic | 22681890 | |
YJFB_SCHPO | SPCC306.11 | genetic | 22681890 | |
ATPB_SCHPO | atp2 | genetic | 22681890 | |
MU137_SCHPO | mug137 | genetic | 22681890 | |
DOP1_SCHPO | SPAPB21F2.02 | genetic | 22681890 | |
MCL1_SCHPO | mcl1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...