ELP4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ELP4_SCHPO
• UniProt AC: Q9USP1
• Protein Name: Elongator complex protein 4
• Gene Name: elp4
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 361
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Acts as component of the RNA polymerase II elongator complex, which is a major histone acetyltransferase component of the RNA polymerase II (RNAPII) holoenzyme and is involved in transcriptional elongation. Association with elongating RNAPII requires a hyperphosphorylated state of the RNAPII C-terminal domain (CTD). Elongator binds to both naked and nucleosomal DNA, can acetylate both core and nucleosomal histones, and is involved in chromatin remodeling. It acetylates histones H3, preferentially at 'Lys-14', and H4, preferentially at 'Lys-8'. May be involved in tRNA modification. Elp4 is required for the complex integrity and the complex HAT activity but is not required for the association of the complex with nascent RNA transcript. Is required for an early step in synthesis of 5-methoxycarbonylmethyl (mcm5) and 5-carbamoylmethyl (ncm5) groups present on uridines at the wobble position in tRNA (By similarity)..
• Protein Sequence: MSFKRKAAPQIAPTNLPTGVRLSSKDARWITSSGSSSFDYYLSGGIPMKSLLVIEEDSMDYASVLLKFFAAEGLKQDHVIWLGPSIGEMWFRQLPGDSDRPNKNENSAGEDNHSSPPSKNPQQERMKIAWRYEQVSKTKAPTLDMIPPGYTHSFDLSKNLIVKSDMKYAVSPFPLETGSNPYAPVIESLTRFLSTLTPGTVCRLVLPSILSPAFYSIRATHPQHFIRFIHTLSSLIKCTTSVHLICMCSVPSTLFSRDCEQIFWLENLASAVFSLHPFPVKETVNGLVTQPLGLFRIHKLPLALPFTNHANSNEAGDLSFTVSKRRFTIEPWVLPPLDDEQKDTKISNTNPQKQPVKSLDF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
107	Phosphorylation	RPNKNENSAGEDNHS CCCCCCCCCCCCCCC	31.32	29996109
114	Phosphorylation	SAGEDNHSSPPSKNP CCCCCCCCCCCCCCH	51.28	21712547
115	Phosphorylation	AGEDNHSSPPSKNPQ CCCCCCCCCCCCCHH	33.02	24763107
118	Phosphorylation	DNHSSPPSKNPQQER CCCCCCCCCCHHHHH	48.74	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ELP4_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ELP4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ELP4_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HIF2_SCHPO	hif2	genetic	18818364
PEF1_SCHPO	pef1	genetic	18818364
HRR1_SCHPO	hrr1	genetic	18818364
MU154_SCHPO	mug154	genetic	18818364
SPP1_SCHPO	spf1	genetic	18818364
RAF1_SCHPO	raf1	genetic	18818364
RAF2_SCHPO	raf2	genetic	18818364

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.