UniProt ID | YQF1_SCHPO | |
---|---|---|
UniProt AC | O94394 | |
Protein Name | Uncharacterized WD repeat-containing protein C126.01c | |
Gene Name | SPCC126.01c, SPCC576.18c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 369 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MQTNNPSYFFRSESALQDEKRKEEKSHNPNGNPRNLKAKILNIELDRTTPKKKQFPRLFVCEASHICKLYDLEINKTCKTYKGHSGPVTCCQIESLRKDGKVRHIYTGSWDHTIKKWNVSTGECVETLIGHTDYVKCLLLLEEEGLLLSGSTDASLIVWDVSSQPSRLLYKLTGHSRGIECITRQPNTDIFWTCGSESSIRCWHITKVGGSQLEEEGFWGHQSNVYCLLFDPQDSEALWTASADKTVREWSLYQGIHEETRMEHPDVCTDVLTLADGNIATACRDEEIRVWDTTTGNVKDIYSGHYESVTKILQWKSYLISSSLDQTIRVWDLEYSADNNEADDHPSLGPPSTKLTAEELAELEELMND | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YQF1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YQF1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YQF1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SFT1_SCHPO | sft1 | genetic | 22681890 | |
YG58_SCHPO | SPBC56F2.08c | genetic | 22681890 | |
CLR4_SCHPO | clr4 | genetic | 22681890 | |
COM1_SCHPO | ctp1 | genetic | 22681890 | |
YOR2_SCHPO | rng9 | genetic | 22681890 | |
YE87_SCHPO | SPAC9G1.07 | genetic | 22681890 | |
SEC14_SCHPO | spo20 | genetic | 22681890 | |
GLD1_SCHPO | gld1 | genetic | 22681890 | |
YKN4_SCHPO | mca1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...