dbPTM

YQF1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YQF1_SCHPO
UniProt AC	O94394
Protein Name	Uncharacterized WD repeat-containing protein C126.01c
Gene Name	SPCC126.01c, SPCC576.18c
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	369
Subcellular Localization
Protein Description
Protein Sequence	MQTNNPSYFFRSESALQDEKRKEEKSHNPNGNPRNLKAKILNIELDRTTPKKKQFPRLFVCEASHICKLYDLEINKTCKTYKGHSGPVTCCQIESLRKDGKVRHIYTGSWDHTIKKWNVSTGECVETLIGHTDYVKCLLLLEEEGLLLSGSTDASLIVWDVSSQPSRLLYKLTGHSRGIECITRQPNTDIFWTCGSESSIRCWHITKVGGSQLEEEGFWGHQSNVYCLLFDPQDSEALWTASADKTVREWSLYQGIHEETRMEHPDVCTDVLTLADGNIATACRDEEIRVWDTTTGNVKDIYSGHYESVTKILQWKSYLISSSLDQTIRVWDLEYSADNNEADDHPSLGPPSTKLTAEELAELEELMND

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
14	Phosphorylation	SYFFRSESALQDEKR HHHCCCHHHHHHHHH	35.21	25720772
347	Phosphorylation	NEADDHPSLGPPSTK CCCCCCCCCCCCCCC	42.40	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YQF1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YQF1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YQF1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SFT1_SCHPO	sft1	genetic	22681890
YG58_SCHPO	SPBC56F2.08c	genetic	22681890
CLR4_SCHPO	clr4	genetic	22681890
COM1_SCHPO	ctp1	genetic	22681890
YOR2_SCHPO	rng9	genetic	22681890
YE87_SCHPO	SPAC9G1.07	genetic	22681890
SEC14_SCHPO	spo20	genetic	22681890
GLD1_SCHPO	gld1	genetic	22681890
YKN4_SCHPO	mca1	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YQF1_SCHPO

Related Literatures of Post-Translational Modification