UniProt ID | TRM82_SCHPO | |
---|---|---|
UniProt AC | O74863 | |
Protein Name | tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit trm82 {ECO:0000255|HAMAP-Rule:MF_03056} | |
Gene Name | trm82 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 421 | |
Subcellular Localization | Nucleus . | |
Protein Description | Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. In the complex, it is required to stabilize and induce conformational changes of the catalytic subunit.. | |
Protein Sequence | MSEQRVFKHPCQFLTWNSKHNYIVCCSGPYLLGFSCSTGEKIFEHCYRDNINEKHREAAAYGEAIRQVAFSKDYSRMATVSEDKCLRLWDSTQPDKIELLYQKNIPKRCADLCFAGSNEIVFGDKFGDVYCVDENWFTTSEVTEEKKSNVVEGKQEPVNNDTLKDSKLQKLEPIMGHVSILTQLIVAQNPQNSKEEIIITSDKDEHIRISRFPNAFVIEGFCLGHEDFVSRMSLYDNRTLISGGGDNHVFVWDLENFKCLDAFDLRSAFSTYLSLNQPMVVSVILPIFKRQLVAFACEGMAGLIFAKVTPEKRLLFHSALKLSGPVLDAVLLDTDTDQILISLDSSFTFGACFECVKFDEGNAAVLTKPDVIKRIESDGLISTEKPFCPLAQIHTLRKNHSKFIRSVETGTSSPSVESKDN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
406 | Phosphorylation | NHSKFIRSVETGTSS HHHHHHEECCCCCCC | 21.35 | 21712547 | |
409 | Phosphorylation | KFIRSVETGTSSPSV HHHEECCCCCCCCCC | 43.53 | 21712547 | |
411 | Phosphorylation | IRSVETGTSSPSVES HEECCCCCCCCCCCC | 33.19 | 25720772 | |
412 | Phosphorylation | RSVETGTSSPSVESK EECCCCCCCCCCCCC | 41.41 | 29996109 | |
413 | Phosphorylation | SVETGTSSPSVESKD ECCCCCCCCCCCCCC | 22.49 | 28889911 | |
415 | Phosphorylation | ETGTSSPSVESKDN- CCCCCCCCCCCCCC- | 40.23 | 25720772 | |
418 | Phosphorylation | TSSPSVESKDN---- CCCCCCCCCCC---- | 43.06 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRM82_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRM82_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRM82_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...