UniProt ID | YHM3_SCHPO | |
---|---|---|
UniProt AC | O94336 | |
Protein Name | Uncharacterized FCP1 homology domain-containing protein C1271.03c | |
Gene Name | SPBC1271.03c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 244 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAPEPSLTYLSQASSCNGATDNRKLVILDLNGTLLCRALAVRSEKSVYEASRNPIPRPGLHNFLKYIFANFSVMVFSSSKPHNVQAMLSAIMNEEQKKALIACWTRVDMKLTKHQFDRKVQTYKNLDTVWEKIHHDSTGKPVSWSQYNTIIVDDSKTKCAAHPYNHIAVSDFVAKSHSNIPKDIELACVIRYLKHLKSVPNVSYYIYKFPFKILADKSLEDNLKYLDELDENYKKECQVDNPQP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YHM3_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YHM3_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YHM3_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YHM3_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DDB1_SCHPO | ddb1 | genetic | 22681890 | |
DBR1_SCHPO | dbr1 | genetic | 22681890 | |
ERG5_SCHPO | erg5 | genetic | 22681890 | |
MIC10_SCHPO | SPAPJ691.03 | genetic | 22681890 | |
TSPO_SCHPO | SPBC725.10 | genetic | 22681890 | |
SSN3_SCHPO | srb10 | genetic | 22681890 | |
YIDH_SCHPO | SPAC227.17c | genetic | 22681890 | |
YCO6_SCHPO | nap1 | genetic | 22681890 | |
YBPD_SCHPO | SPBC16H5.13 | genetic | 22681890 | |
TOM70_SCHPO | tom70 | genetic | 22681890 | |
FFT3_SCHPO | fft3 | genetic | 22681890 | |
RL21B_SCHPO | rpl2102 | genetic | 22681890 | |
MUG73_SCHPO | mug73 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...