UniProt ID | OS9_SCHPO | |
---|---|---|
UniProt AC | Q9UTC8 | |
Protein Name | Protein OS-9 homolog | |
Gene Name | yos9 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 310 | |
Subcellular Localization |
Endoplasmic reticulum membrane Peripheral membrane protein Lumenal side. |
|
Protein Description | Lectin involved in the quality control of the secretory pathway. As a member of the endoplasmic reticulum-associated degradation lumenal (ERAD-L) surveillance system, targets misfolded endoplasmic reticulum lumenal glycoproteins for degradation (By similarity).. | |
Protein Sequence | MFSSSMFPHLILPAIGSSKVRTMVLPFAFVGFFIFPICLASLLDWNDAYEYPKYSFEWSNVSILEGDIDSIKEKTEKTKLSSLFYAGKHEYFCVYPNASLIKQNSTTEPSYDLQELRIQGTEKINELANVFLIENRGYWTYDYVYGQHVRQYHLEPQQGSDKVLANPMYILGTAPNTQTKKNLEENWAIGFVEGKAYLQTTFRNGTMCDITKRPRHVILSYECSTNSDTPEITQYQEVSSCAYSMTIHVPGLCSLPAFKIQEDIPSEKIVCYNVIKEKSNEVDHKDSQHVVDEVAQTSPPEVKEVETQSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
60 | N-linked_Glycosylation | KYSFEWSNVSILEGD CCEEECCCEEEEECC | 32.40 | - | |
97 | N-linked_Glycosylation | EYFCVYPNASLIKQN EEEEEECCHHHEECC | 25.19 | - | |
104 | N-linked_Glycosylation | NASLIKQNSTTEPSY CHHHEECCCCCCCCC | 36.00 | - | |
204 | N-linked_Glycosylation | YLQTTFRNGTMCDIT EEEEEECCCCEEECC | 46.20 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OS9_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OS9_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OS9_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of OS9_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...