dbPTM

OS9_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	OS9_SCHPO
UniProt AC	Q9UTC8
Protein Name	Protein OS-9 homolog
Gene Name	yos9
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	310
Subcellular Localization	Endoplasmic reticulum membrane Peripheral membrane protein Lumenal side.
Protein Description	Lectin involved in the quality control of the secretory pathway. As a member of the endoplasmic reticulum-associated degradation lumenal (ERAD-L) surveillance system, targets misfolded endoplasmic reticulum lumenal glycoproteins for degradation (By similarity)..
Protein Sequence	MFSSSMFPHLILPAIGSSKVRTMVLPFAFVGFFIFPICLASLLDWNDAYEYPKYSFEWSNVSILEGDIDSIKEKTEKTKLSSLFYAGKHEYFCVYPNASLIKQNSTTEPSYDLQELRIQGTEKINELANVFLIENRGYWTYDYVYGQHVRQYHLEPQQGSDKVLANPMYILGTAPNTQTKKNLEENWAIGFVEGKAYLQTTFRNGTMCDITKRPRHVILSYECSTNSDTPEITQYQEVSSCAYSMTIHVPGLCSLPAFKIQEDIPSEKIVCYNVIKEKSNEVDHKDSQHVVDEVAQTSPPEVKEVETQSS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
60	N-linked_Glycosylation	KYSFEWSNVSILEGD CCEEECCCEEEEECC	32.40	-
97	N-linked_Glycosylation	EYFCVYPNASLIKQN EEEEEECCHHHEECC	25.19	-
104	N-linked_Glycosylation	NASLIKQNSTTEPSY CHHHEECCCCCCCCC	36.00	-
204	N-linked_Glycosylation	YLQTTFRNGTMCDIT EEEEEECCCCEEECC	46.20	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of OS9_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of OS9_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of OS9_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of OS9_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of OS9_SCHPO

Related Literatures of Post-Translational Modification