dbPTM

YNT3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YNT3_SCHPO
UniProt AC	Q9Y7M3
Protein Name	FYVE-type zinc finger-containing protein C9B6.03
Gene Name	SPBC9B6.03
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	293
Subcellular Localization	Vacuole membrane Peripheral membrane protein .
Protein Description
Protein Sequence	MTTVHQLSGHGPLSRLNIYSGASPYTQRVRPSYELIEAPTRQATNGTGSVSGSPNSSSNSTPANQGSLPSHTNPQLYSSITRKERPELFRSYSGNPRLSKPYASSKLAASSRTASYQAMSYSVSPTSTNSSVATSLNYQSSRETGISKDHWKPDSDVSVCSFPSCSVRFGLFDRRHHCRRCGDIFCALHCDRNIPLTMDVKFCLAGSLYRSCVSCFYEYLKWKQSIDLASSNDITVIESTIAPQQATTHPPSQPKNAVSVPIPKMDSTDSKGELPSESLVLGTVPDNWVWSTF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MTTVHQLSGH -----CCCCHHHCCC	18.07	29996109
8	Phosphorylation	MTTVHQLSGHGPLSR CCCCHHHCCCCCCHH	23.36	29996109
19	Phosphorylation	PLSRLNIYSGASPYT CCHHHEECCCCCCCC	10.44	29996109
20	Phosphorylation	LSRLNIYSGASPYTQ CHHHEECCCCCCCCC	24.88	29996109
23	Phosphorylation	LNIYSGASPYTQRVR HEECCCCCCCCCCCC	23.20	29996109
32	Phosphorylation	YTQRVRPSYELIEAP CCCCCCCCEEEEECC	22.22	29996109
104	Phosphorylation	RLSKPYASSKLAASS CCCCCCHHCHHHHCC	23.35	25720772
105	Phosphorylation	LSKPYASSKLAASSR CCCCCHHCHHHHCCC	24.42	29996109
110	Phosphorylation	ASSKLAASSRTASYQ HHCHHHHCCCCCEEE	18.10	25720772
111	Phosphorylation	SSKLAASSRTASYQA HCHHHHCCCCCEEEE	28.99	25720772
207	Phosphorylation	VKFCLAGSLYRSCVS HHHHHHHHHHHHHHH	19.34	25720772
259	Phosphorylation	SQPKNAVSVPIPKMD CCCCCCEECCCCCCC	21.55	28889911
283	Phosphorylation	SESLVLGTVPDNWVW CCCEEEEECCCCEEE	25.38	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YNT3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YNT3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YNT3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YNT3_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YNT3_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-259, AND MASSSPECTROMETRY.	18257517 [Abstract]