dbPTM

PYRD_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PYRD_SCHPO
UniProt AC	P32747
Protein Name	Dihydroorotate dehydrogenase (quinone), mitochondrial
Gene Name	ura3
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	443
Subcellular Localization	Mitochondrion inner membrane Single-pass membrane protein .
Protein Description	In the de novo pyrimidine biosynthesis pathway, catalyzes the stereospecific oxidation of (S)-dihydroorotate to orotate with reduction of flavin and the transfer of electrons to ubiquinone, which is part of the repiratory chain. Does not use fumarate and NAD as electron acceptors..
Protein Sequence	MYQRSLFRGVAQGLKRSSVRFQSTSSGSSNGNFFLRHWKLLSVIGSFTAGVAIYDMSDVRSFIHGRIEMPLFHAFTTPEFSHRVAILAASWGITPKDRVADDPSLAVEVWGKKFCNPIGLAAGFDKQADAISGLLNFGFSYLEIGSVTPKPQPGNPKPRYFRLKPDLSVINRYGFNSIGHDAILAKIQKRVRKYIAKTSPQLLKQFDANPASCTDPAVLGVPRSLIPNKFLGINLGKNKNGNEIEDYVEGVRTFGNFADILVINVSSPNTPGLRNLQKKSALSTLLTAVVSERNKLNSPHPPVLVKIAPDLNEEELTDIADVLKKCKIDGVIVGNTTVQRPKTLKSTSHVEETGGLSGPPLKPIALNTLRTLRKHLSSDIPIIGCGGISSGKDAIEYARAGATMVQVYTALGYDGPVIAHKIKQEILAELKGKRWVDIIGKEE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
5	Phosphorylation	---MYQRSLFRGVAQ ---CCCHHHHHHHHH	19.14	21712547
168	Phosphorylation	FRLKPDLSVINRYGF EEECCCCEEHHCCCC	28.47	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PYRD_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PYRD_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PYRD_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PYRD_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PYRD_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168, AND MASSSPECTROMETRY.	18257517 [Abstract]