OAC1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OAC1_SCHPO
• UniProt AC: Q9UTN1
• Protein Name: Mitochondrial oxaloacetate transport protein
• Gene Name: oac1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 320
• Subcellular Localization: Mitochondrion inner membrane; Multi-pass membrane protein.
• Protein Description: Transports oxaloacetate and sulfate..
• Protein Sequence: MSEKQTIKALPAHNPTQVKKLGPVSGFLSGGLAACGAVTLTNPFEVIKTRFQLQGQLTKLDPSKRIYKSVGQAFSLIARHEGIRGLQRGLGTAYVYQICLNGCRLGFYEPIRRTLNTWFLDDPKGNKLAINVASGAGSGLCGALFGSPFFLVKTRMQSYSPKFPVGQQYGYKHIFNAFSRIIKENGVKGLFVGADAAILRTVSGSSVQLPIYNWAKRMIEHYNLLEEGMIKHLTASAVSGFGVCCTMQIFDTVMTRMYNQKNKELYKNPIDCILKTIRSEGFFALYKGFGAHLARIAPHTIFCLTFVEQTNKLFLKFQKD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
69	Phosphorylation	PSKRIYKSVGQAFSL HHHHHHHHHHHHHHH	17.95	25720772
279	Phosphorylation	CILKTIRSEGFFALY HHHHHHHCCCCCHHH	37.92	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OAC1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OAC1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OAC1_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of OAC1_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.