| UniProt ID | YFFE_SCHPO | |
|---|---|---|
| UniProt AC | O94455 | |
| Protein Name | Uncharacterized calcium-binding protein C1687.14c | |
| Gene Name | SPAC1687.14c | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 76 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | ||
| Protein Sequence | MSVSTKRLEMDEEAEEAFDLFDVTHKGYIDFEDLRRSCAQLGENLTKEQLQLMLDLAGTNGKVSREEFAELWIHIS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YFFE_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YFFE_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YFFE_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YFFE_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DCC1_SCHPO | dcc1 | genetic | 18818364 | |
| RAD14_SCHPO | rhp14 | genetic | 18818364 | |
| HPC2_SCHPO | hip4 | genetic | 18818364 | |
| PEF1_SCHPO | pef1 | genetic | 18818364 | |
| ALP14_SCHPO | alp14 | genetic | 18818364 | |
| TSC2_SCHPO | tsc2 | genetic | 22681890 | |
| CTBL1_SCHPO | SPAC1952.06c | genetic | 22681890 | |
| UFD2_SCHPO | ufd2 | genetic | 22681890 | |
| FEP1_SCHPO | fep1 | genetic | 22681890 | |
| UBC15_SCHPO | ubc15 | genetic | 22681890 | |
| HOSM_SCHPO | lys4 | genetic | 22681890 | |
| SSN3_SCHPO | srb10 | genetic | 22681890 | |
| LYS4_SCHPO | lys2 | genetic | 22681890 | |
| JMJ2_SCHPO | jmj2 | genetic | 22681890 | |
| IWR1_SCHPO | iwr1 | genetic | 22681890 | |
| EMC1_SCHPO | emc1 | genetic | 22681890 | |
| RCD1_SCHPO | rcd1 | genetic | 22681890 | |
| YLOH_SCHPO | SPAC1952.17c | genetic | 22681890 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...