UniProt ID | YFFE_SCHPO | |
---|---|---|
UniProt AC | O94455 | |
Protein Name | Uncharacterized calcium-binding protein C1687.14c | |
Gene Name | SPAC1687.14c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 76 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | ||
Protein Sequence | MSVSTKRLEMDEEAEEAFDLFDVTHKGYIDFEDLRRSCAQLGENLTKEQLQLMLDLAGTNGKVSREEFAELWIHIS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YFFE_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YFFE_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YFFE_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YFFE_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DCC1_SCHPO | dcc1 | genetic | 18818364 | |
RAD14_SCHPO | rhp14 | genetic | 18818364 | |
HPC2_SCHPO | hip4 | genetic | 18818364 | |
PEF1_SCHPO | pef1 | genetic | 18818364 | |
ALP14_SCHPO | alp14 | genetic | 18818364 | |
TSC2_SCHPO | tsc2 | genetic | 22681890 | |
CTBL1_SCHPO | SPAC1952.06c | genetic | 22681890 | |
UFD2_SCHPO | ufd2 | genetic | 22681890 | |
FEP1_SCHPO | fep1 | genetic | 22681890 | |
UBC15_SCHPO | ubc15 | genetic | 22681890 | |
HOSM_SCHPO | lys4 | genetic | 22681890 | |
SSN3_SCHPO | srb10 | genetic | 22681890 | |
LYS4_SCHPO | lys2 | genetic | 22681890 | |
JMJ2_SCHPO | jmj2 | genetic | 22681890 | |
IWR1_SCHPO | iwr1 | genetic | 22681890 | |
EMC1_SCHPO | emc1 | genetic | 22681890 | |
RCD1_SCHPO | rcd1 | genetic | 22681890 | |
YLOH_SCHPO | SPAC1952.17c | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...