GLRX5_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GLRX5_SCHPO
• UniProt AC: Q9HDW8
• Protein Name: Monothiol glutaredoxin-5
• Gene Name: grx5
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 146
• Subcellular Localization: Mitochondrion .
• Protein Description: Thiol reductase involved in the biogenesis of iron-sulfur clusters. Required for normal iron homeostasis. Required for integrity of mitochondrial DNA. May play a crucial role in responses to nitrosative and osmotic stresses..
• Protein Sequence: MNSMFRFWIPKTSISMQLRMLSTQTRQALEQAVKEDPIVLFMKGTPTRPMCGFSLKAIQILSLENVASDKLVTYNVLSNDELREGIKEFSDWPTIPQLYINGEFVGGSDILASMHKSGELHKILKEINALAPEQPKDSEEETTKKD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of GLRX5_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GLRX5_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GLRX5_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GLRX5_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GLRX2_SCHPO	grx2	genetic	20085751
ISA1_SCHPO	isa1	genetic	20085751
MAS5_SCHPO	mas5	genetic	20085751
SSB1_SCHPO	sks2	genetic	20085751
ISA2_SCHPO	isa2	genetic	20085751
ISA1_SCHPO	isa1	physical	20085751
ISA2_SCHPO	isa2	physical	20085751

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.