UniProt ID | GLRX5_SCHPO | |
---|---|---|
UniProt AC | Q9HDW8 | |
Protein Name | Monothiol glutaredoxin-5 | |
Gene Name | grx5 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 146 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Thiol reductase involved in the biogenesis of iron-sulfur clusters. Required for normal iron homeostasis. Required for integrity of mitochondrial DNA. May play a crucial role in responses to nitrosative and osmotic stresses.. | |
Protein Sequence | MNSMFRFWIPKTSISMQLRMLSTQTRQALEQAVKEDPIVLFMKGTPTRPMCGFSLKAIQILSLENVASDKLVTYNVLSNDELREGIKEFSDWPTIPQLYINGEFVGGSDILASMHKSGELHKILKEINALAPEQPKDSEEETTKKD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of GLRX5_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLRX5_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLRX5_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLRX5_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GLRX2_SCHPO | grx2 | genetic | 20085751 | |
ISA1_SCHPO | isa1 | genetic | 20085751 | |
MAS5_SCHPO | mas5 | genetic | 20085751 | |
SSB1_SCHPO | sks2 | genetic | 20085751 | |
ISA2_SCHPO | isa2 | genetic | 20085751 | |
ISA1_SCHPO | isa1 | physical | 20085751 | |
ISA2_SCHPO | isa2 | physical | 20085751 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...