UniProt ID | RL37B_SCHPO | |
---|---|---|
UniProt AC | P05733 | |
Protein Name | 60S ribosomal protein L37-B | |
Gene Name | rpl3702 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 91 | |
Subcellular Localization | ||
Protein Description | Binds to the 23S rRNA.. | |
Protein Sequence | MTKGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTGRMSYLKKVHRSFKNGFRSGKPAAAVAASA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTKGTQSFG ------CCCCCCCCC | 37.88 | 29996109 | |
26 | Phosphorylation | CRRCGKRSFHIQKST HHHCCCCEEEECCCC | 25.35 | 25720772 | |
32 | Phosphorylation | RSFHIQKSTCACCGY CEEEECCCCCCCCCC | 16.61 | 25720772 | |
33 | Phosphorylation | SFHIQKSTCACCGYP EEEECCCCCCCCCCC | 15.91 | 25720772 | |
44 | Phosphorylation | CGYPAAKTRSYNWGA CCCCCCHHCCCCCCC | 21.81 | 24763107 | |
80 | Phosphorylation | SFKNGFRSGKPAAAV HHHCCCCCCCCCHHH | 49.24 | 28889911 | |
90 | Phosphorylation | PAAAVAASA------ CCHHHHHCC------ | 25.44 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL37B_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL37B_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL37B_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RL37B_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...