dbPTM

RS8A_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RS8A_SCHPO
UniProt AC	O14049
Protein Name	40S ribosomal protein S8-A
Gene Name	rps801
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	200
Subcellular Localization
Protein Description
Protein Sequence	MGITRDSRHKRSATGAKRAQYRKKRKFELGRQPSNTRIGPKRIHEVRVRGGNKKFRALRLDSGNFSWGSEGVSKKTRIIQVAYHPSNNELVRTNTLTKSAIVQIDAAPFRVWYETHYGILMGSKGKKATSTPNPKSKHVQRKHSARLGDSKVDSALETQFAAGRLYAVVSSRPGQSGRCDGYILEGEELHFYLRRMAPKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
62	Phosphorylation	FRALRLDSGNFSWGS EEEEEECCCCCCCCC	39.98	28889911
66	Phosphorylation	RLDSGNFSWGSEGVS EECCCCCCCCCCCCC	34.23	29996109
69	Phosphorylation	SGNFSWGSEGVSKKT CCCCCCCCCCCCCCE	25.56	28889911
86	Phosphorylation	IQVAYHPSNNELVRT EEEEECCCCCCEEEC	38.69	28889911
99	Phosphorylation	RTNTLTKSAIVQIDA ECCCCCCCEEEEEEC	20.28	28889911
123	Phosphorylation	HYGILMGSKGKKATS EEEEEECCCCCCCCC	25.03	28889911
144	Phosphorylation	KHVQRKHSARLGDSK HHHHHHHHHHCCCHH	20.37	24763107
150	Phosphorylation	HSARLGDSKVDSALE HHHHCCCHHHHHHHH	32.55	28889911
154	Phosphorylation	LGDSKVDSALETQFA CCCHHHHHHHHHHHH	37.43	28889911
171	Phosphorylation	RLYAVVSSRPGQSGR CEEEEEECCCCCCCC	30.77	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RS8A_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RS8A_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RS8A_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
YGNB_SCHPO	nap2	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RS8A_SCHPO

Related Literatures of Post-Translational Modification