SGT2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SGT2_SCHPO
• UniProt AC: O13797
• Protein Name: Small glutamine-rich tetratricopeptide repeat-containing protein 2
• Gene Name: sgt2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 317
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Co-chaperone that binds to the molecular chaperone Hsp70 and regulates Hsp70 ATPase activity..
• Protein Sequence: MSSNKVTAAIIDYLKQAITTGSISEEEKESLEVAAQCIQDSFKIKPEEIKPKSGDRLVAAFEEYEKLHPVEEDSTAHVNKEEAEKLKLEGNNAIAAKDYQKALDLYTKAIEIDPTSPVYYSNRAAAYNQLGQFENAVEDALTCLSLDPHHARAFGRLGRAKLSLGDAAAAADAYKKGLDFDPNNEVLKRGLEAANKQLNQPSDSSATSGADQARTSAGAAPDLGSIFGGGMPDLGSLMNNPAVMNMARNLMQSGALNNIMNDPNIANMARNFQSGGGMPDLSSLANNPQLQNLARNFMNNNNNGNTDNNNQGNPPPQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
24	Phosphorylation	AITTGSISEEEKESL HHHHCCCCHHHHHHH	40.42	21712547
115	Phosphorylation	KAIEIDPTSPVYYSN HHCCCCCCCCCCCHH	41.75	29996109
116	Phosphorylation	AIEIDPTSPVYYSNR HCCCCCCCCCCCHHH	20.11	28889911
205	Phosphorylation	LNQPSDSSATSGADQ HCCCCCCCCCCHHHH	40.32	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SGT2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SGT2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SGT2_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of SGT2_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.