UniProt ID | VAC7_SCHPO | |
---|---|---|
UniProt AC | O94262 | |
Protein Name | Vacuolar segregation protein 7 | |
Gene Name | vac7 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 251 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type II membrane protein . Golgi apparatus membrane Single-pass type II membrane protein . Vacuole membrane Single-pass type II membrane protein. |
|
Protein Description | Component of the PI(3,5)P2 regulatory complex that regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Directly involved in vacuolar membrane scission. Required for normal vacuole acidification, inheritance and morphology (By similarity).. | |
Protein Sequence | MSEPKPMQMSVETETVLNVSQVQIPSSCDRKASLETLKTKKNAQKKKKISLPNVMTSKAAMFAARVASAVDQDPNDEESENFVYENLIPTNDDELHSPSASIHSFQTYNLPLEMLPTINHVPYYGSAGTNALNGGPLSNSRKLIPKRSAKFSSMVGSSDTRCNSPTTARGLATSPLQINPTTSKSPLLNKKLSSTSQEPFRTSRRSGQESGDVTTKMLRNLLHKRLWISFFFACFVVLSLVYFHYAVQPLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | N-linked_Glycosylation | VETETVLNVSQVQIP EEEEEEECHHHCCCC | - | ||
33 | Phosphorylation | SSCDRKASLETLKTK CCCCCCHHHHHHHHH | 25720772 | ||
36 | Phosphorylation | DRKASLETLKTKKNA CCCHHHHHHHHHHHH | 25720772 | ||
152 | Phosphorylation | PKRSAKFSSMVGSSD CCCHHHHHHHCCCCC | 21712547 | ||
160 | Phosphorylation | SMVGSSDTRCNSPTT HHCCCCCCCCCCCCC | 25720772 | ||
164 | Phosphorylation | SSDTRCNSPTTARGL CCCCCCCCCCCCCCC | 21712547 | ||
174 | Phosphorylation | TARGLATSPLQINPT CCCCCCCCCCCCCCC | 29996109 | ||
193 | Phosphorylation | PLLNKKLSSTSQEPF CCCCCCCCCCCCCCH | 29996109 | ||
194 | Phosphorylation | LLNKKLSSTSQEPFR CCCCCCCCCCCCCHH | 21712547 | ||
195 | Phosphorylation | LNKKLSSTSQEPFRT CCCCCCCCCCCCHHH | 29996109 | ||
196 | Phosphorylation | NKKLSSTSQEPFRTS CCCCCCCCCCCHHHC | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VAC7_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VAC7_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VAC7_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VAC7_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...