| UniProt ID | SKB5_SCHPO | |
|---|---|---|
| UniProt AC | Q9US59 | |
| Protein Name | Shk1 kinase-binding protein 5 | |
| Gene Name | skb5 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 140 | |
| Subcellular Localization | ||
| Protein Description | Stimulates catalytic function of the p21-activated kinase homolog shk1.. | |
| Protein Sequence | MAEETEEDYLVVGRDYLYPPDHELHYGFHARVIEEEEERFVDDTFDETIEGSDDSESIDDTEVFYDAEESESTHPSASFNVLADAVALYDFEPLHDNELGFTTGQRLCILSESSDGWLIAYDDASGRSGLVPETFVKLEV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of SKB5_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SKB5_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SKB5_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SKB5_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| STE20_SCHPO | shk1 | genetic | 10593886 | |
| SKB1_SCHPO | skb1 | genetic | 10593886 | |
| PYP1_SCHPO | pyp1 | genetic | 18931302 | |
| YFE6_SCHPO | gmh5 | genetic | 18931302 | |
| MKH1_SCHPO | mkh1 | physical | 22570491 | |
| PUB1_SCHPO | pub1 | genetic | 22681890 | |
| PCK1_SCHPO | pck1 | genetic | 22681890 | |
| EIF2A_SCHPO | SPBC4B4.04 | genetic | 22681890 | |
| YE99_SCHPO | glc9 | genetic | 22681890 | |
| DSC4_SCHPO | dsc4 | genetic | 22681890 | |
| PMP1_SCHPO | pmp1 | genetic | 22681890 | |
| PTPA1_SCHPO | ypa1 | genetic | 22681890 | |
| RL16B_SCHPO | rpl1601 | genetic | 22681890 | |
| TOM70_SCHPO | tom70 | genetic | 22681890 | |
| YJC7_SCHPO | SPCC736.07c | genetic | 22681890 | |
| YFE6_SCHPO | gmh5 | genetic | 22681890 | |
| CLR1_SCHPO | clr1 | genetic | 22681890 | |
| OMH6_SCHPO | omh6 | genetic | 22681890 | |
| PP2C1_SCHPO | ptc1 | physical | 23695164 | |
| SKB5_SCHPO | skb5 | physical | 26771498 | |
| PP2C1_SCHPO | ptc1 | physical | 26771498 | |
| MKH1_SCHPO | mkh1 | physical | 27451356 | |
| PP2C1_SCHPO | ptc1 | physical | 27451356 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
