dbPTM

ETFA_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ETFA_SCHPO
UniProt AC	P78790
Protein Name	Probable electron transfer flavoprotein subunit alpha, mitochondrial
Gene Name	SPAC27D7.06
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	341
Subcellular Localization	Mitochondrion matrix.
Protein Description	The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase) (By similarity)..
Protein Sequence	MLRTTSRTFSRALSSSNFKINCGRRHWFSVLTLLEHQGGNLSPASLSAVEAAKRTGGDVFGFVIGKDSSQISQKVAKSVNDLKKVIYVENPSYEHNIPDQIANVLFENVKKNEISHVFSAHSTVGKGVMPRLAAMFDVMQISDIIGVVSADTFVRPTYAGNVNVTVSTKDPIKIVTVRASAFDAAPSSGEGAATVVEGIDPKPAALQEWVSENIIKNARPDLSSAERVVAGGRPLKDKETFERILTPLADKLGAAIGATRVAVDSGYADNSLQIGQTGKIIAPKLYIAVGIDGAIQHLAGIKDSKVIAAINRDENAPIFQTADVGIVGDLFEIVPELTEKL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
16	Phosphorylation	FSRALSSSNFKINCG HHHHHHCCCCEEECC	42.80	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ETFA_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ETFA_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ETFA_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ETFA_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ETFA_SCHPO

Related Literatures of Post-Translational Modification