dbPTM

ALG10_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ALG10_SCHPO
UniProt AC	Q10254
Protein Name	Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase
Gene Name	alg10
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	445
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein.
Protein Description	Adds the third glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. Transfers glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc(2)Man(9)GlcNAc(2)-PP-Dol..
Protein Sequence	MFLGKAIILILWIFLAFTGLLAIQYYVPNPYLDEIFHIAQAQRFCRKDWDWDPAITTPPGLYLVSVALSPFIGCSNVSLRLINWLVGVIGLPWLINDIVSLLNNRKGDVVTYFAYTLSSLPPLWFFSFLYYTDIGSTFFVLLAYDFALRKSAFSSSVSCFFSLWFRQTNIVWMVFIAVTYFASNMSFFNPHLAEATFADVLLTIISFLGVFLKNLRRFSCPILSYGAVFCSFLAFLLWNGSIVLGDKSHHQASIHLSQINYFLWFFFFFSFPSYIIKYLMSHSRRSKLLSAVFSKKSFLIVSVLLLIAHFNTIFHPFILADNRHYLFYVFNRLFRIWWLKYLGPFSYLILYYFFLDISKLQMTSLTFFLLISTTILTLVPAPLVEFRYFLLPFLFWRFHLPLPSGRECLMEYALHMVINSVTLYIFLFRTFIWPSEPNALQRFMW

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
76	N-linked_Glycosylation	SPFIGCSNVSLRLIN CCCCCCCHHHHHHHH	31.32	-
239	N-linked_Glycosylation	FLAFLLWNGSIVLGD HHHHHHHCCEEEECC	34.01	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ALG10_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ALG10_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ALG10_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ALG10_SCHPO	alg10	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ALG10_SCHPO

Related Literatures of Post-Translational Modification