dbPTM

REC7_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	REC7_SCHPO
UniProt AC	P36625
Protein Name	Meiotic recombination protein rec7
Gene Name	rec7
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	339
Subcellular Localization
Protein Description	May be involved primarily in the early steps of meiotic recombination..
Protein Sequence	MNIFPIVKYSVAEDSYTTDSSHINWSHYSDGGFTLSLTSGLLQIRQHEELIQSINLLDLWHQLIPGTKEKCLTLLSRAPCMNIRAFTNNVMKRFQVKFPSDVHYMKAKVEFEKLGLVFKDAKSSSEKKQFNNSQSQSNNSQELSLMNNAYNKSSAQQPNLLLQPSYIPMTQTATTAVNNSTNYVNPAPLQHVMPNAEIFSNTPPLKRFRGDAGMTQMPLRSDTSIESITASQQPTWDENVVITSSPFNPNRNAYSYGANSQYPIIAATPLNSQTQASWVAQPENQAYANLIPSPPTTSQILPTELTEEEKQLRSKVLFYLKQDSFIQLCQSLERVWNKM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of REC7_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of REC7_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of REC7_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of REC7_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
REC24_SCHPO	rec24	physical	20364342
REC24_SCHPO	rec24	physical	21429938
REC24_SCHPO	rec24	physical	22841486
REC7_SCHPO	rec7	physical	22841486
REC15_SCHPO	rec15	physical	22841486
RYH1_SCHPO	ryh1	genetic	22681890
YGA3_SCHPO	SPBC6B1.03c	genetic	22681890
QCR8_SCHPO	qcr8	genetic	22681890
HMT2_SCHPO	hmt2	genetic	22681890
RL27A_SCHPO	rpl2701	genetic	22681890
SEC14_SCHPO	spo20	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of REC7_SCHPO

Related Literatures of Post-Translational Modification