UniProt ID | REC7_SCHPO | |
---|---|---|
UniProt AC | P36625 | |
Protein Name | Meiotic recombination protein rec7 | |
Gene Name | rec7 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 339 | |
Subcellular Localization | ||
Protein Description | May be involved primarily in the early steps of meiotic recombination.. | |
Protein Sequence | MNIFPIVKYSVAEDSYTTDSSHINWSHYSDGGFTLSLTSGLLQIRQHEELIQSINLLDLWHQLIPGTKEKCLTLLSRAPCMNIRAFTNNVMKRFQVKFPSDVHYMKAKVEFEKLGLVFKDAKSSSEKKQFNNSQSQSNNSQELSLMNNAYNKSSAQQPNLLLQPSYIPMTQTATTAVNNSTNYVNPAPLQHVMPNAEIFSNTPPLKRFRGDAGMTQMPLRSDTSIESITASQQPTWDENVVITSSPFNPNRNAYSYGANSQYPIIAATPLNSQTQASWVAQPENQAYANLIPSPPTTSQILPTELTEEEKQLRSKVLFYLKQDSFIQLCQSLERVWNKM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of REC7_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of REC7_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of REC7_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of REC7_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
REC24_SCHPO | rec24 | physical | 20364342 | |
REC24_SCHPO | rec24 | physical | 21429938 | |
REC24_SCHPO | rec24 | physical | 22841486 | |
REC7_SCHPO | rec7 | physical | 22841486 | |
REC15_SCHPO | rec15 | physical | 22841486 | |
RYH1_SCHPO | ryh1 | genetic | 22681890 | |
YGA3_SCHPO | SPBC6B1.03c | genetic | 22681890 | |
QCR8_SCHPO | qcr8 | genetic | 22681890 | |
HMT2_SCHPO | hmt2 | genetic | 22681890 | |
RL27A_SCHPO | rpl2701 | genetic | 22681890 | |
SEC14_SCHPO | spo20 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...