REC15_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: REC15_SCHPO
• UniProt AC: Q09094
• Protein Name: Meiotic recombination protein rec15
• Gene Name: rec15
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 180
• Subcellular Localization: Nucleus .
• Protein Description: Required during the early stages of meiosis for meiotic recombination. Involved in chromosome segregation where it is required for separation of sister chromatids in all three chromosomes..
• Protein Sequence: MSYSVSAAQLWSRKLAMQAEDMQQHQKSQSNQIASCLAEMNTKQEVVNQTIGQLGRSISEVQQQNSQLVLQSLNQINMSMQQVALGIQDYASRINKLEQTMSDMNLKFEALQKEQNSNTKTLADCTSQMTIITKKLDAELKKRYMTTKQTRTVQNQTMPRSNTTTKKRVLAIDFLADDDY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of REC15_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of REC15_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of REC15_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of REC15_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MDE2_SCHPO	mde2	physical	22841486
REC10_SCHPO	rec10	physical	22841486
REC15_SCHPO	rec15	physical	22841486
REC24_SCHPO	rec24	physical	22841486
REC7_SCHPO	rec7	physical	22841486
YGNB_SCHPO	nap2	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.