dbPTM

REC24_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	REC24_SCHPO
UniProt AC	Q9UUJ4
Protein Name	Meiotic recombination protein rec24
Gene Name	rec24
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	350
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Required for correct meiotic chromosome segregation and recombination..
Protein Sequence	MNGTNTEDNSKQILIQTMYTYDSSGETLKIAIAWKIILKKPKGKNIKDYIEALRKGIEDQEHCEKYASTLLEPRPKTKKDVVLKNSNVTECVALKAKPFSKKIEDMDIFLLTNVHENLQEKRQTSGSLAHLDIEYTFNGLFRFLKCTADIKLKQTKVYEGADFLRIKTLFEEIFMFLKRDCKSPLVLTRLVELGDYVLDLIIITQSIMQNNANNGTGVISRAKFLEFYVFLEQLIFNKLSFASVEQLEKLLDQIVKRMKICFTYCKNDNPSIRLLYSECFFSYAEIYFPCLHSFDAQLSSAASKCVQILRDIITNEELQTDKQELSKSAYSAPSILLIGLKDMLFPEDIS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of REC24_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of REC24_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of REC24_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of REC24_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
REC7_SCHPO	rec7	physical	20364342
REC7_SCHPO	rec7	physical	22841486
REC15_SCHPO	rec15	physical	22841486

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of REC24_SCHPO

Related Literatures of Post-Translational Modification