UniProt ID | TRM5_SCHPO | |
---|---|---|
UniProt AC | Q8TFG7 | |
Protein Name | tRNA (guanine(37)-N1)-methyltransferase {ECO:0000255|HAMAP-Rule:MF_03152} | |
Gene Name | trm5 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 450 | |
Subcellular Localization | Mitochondrion matrix . Nucleus . Cytoplasm . Predominantly in the mitochondria and in the nucleus. | |
Protein Description | Specifically methylates the N1 position of guanosine-37 in various cytoplasmic and mitochondrial tRNAs. Methylation is not dependent on the nature of the nucleoside 5' of the target nucleoside. This is the first step in the biosynthesis of wybutosine (yW), a modified base adjacent to the anticodon of tRNAs and required for accurate decoding.. | |
Protein Sequence | MHLQIRTVHNMAELLHPNKVEMKPFLKNLDKNLFKKTYNLVAAKVSPKKVGLLNKVCKKDLLDWPRVKHVYQQNNEKLVLLNRDASLDGTRGLSDATVSFIKENNIELVPFQLTLDYDYWRADDILDAILPPGEKEDHPSGFTAVGHIAHMNLREEWLPYKYIIGKVILDKNPSIETVVNKTDTIDTKFRTFQMEVLAGKDDFIVTQSESNCKFRFDFSKVYWNSRLSTEHDRLIQQFQPGDAVCDVMAGVGPFACPAGKKNVIVFANDLNPYSYESLVENIFLNKVANFVKAFNQDGREFIRSSVQKLLGFSKDEKAITVFPPRKRARKLEENKDPVRQDIPIPPVFSHYVMNLPGSAIEFLDAFKGCYYGLEYLFKDRSLPKVHVHCFCRFPDPEEDLINRIYASLGYRFSPEEVDFYYVRKVAPNKDMYCCTFTLPGSIIFAKPVSG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of TRM5_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRM5_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRM5_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRM5_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TRM5_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...