dbPTM

MOA1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MOA1_SCHPO
UniProt AC	Q9UTI4
Protein Name	Monopolar attachment protein 1
Gene Name	moa1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	172
Subcellular Localization	Nucleus. Chromosome, centromere . Chromosome, centromere, kinetochore . Localizes to the centromere. Does not require rec8 for centromeric localization but instead cnp3.
Protein Description	Plays an important role in chromosome segregation during meiosis I by allowing meiotic rec8 to establish cohesion at the centromeric central core and thereby promote the side-by-side structure of kinetochores at meiosis I. Enables monopolar attachment during meiosis I. [PubMed: 16303567]
Protein Sequence	MAINNENELEYKLIKKNKNPKISNSKKKNSTRPALQDKTNQTLPIHQNQAFSNILPSDFSIIKTPETKTADDFPVNGYEGLNILKFDLELFYKLKPVATSTPKSCMRTGSNLFLNETVKHVPDERLVSNIKNTQTKDSITRDSAYYHRKTMTESIIKTLAAFDAEVDEIILF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MOA1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MOA1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MOA1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MOA1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
REC8_SCHPO	rec8	physical	16325576
CLR6_SCHPO	clr6	genetic	21979813

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MOA1_SCHPO

Related Literatures of Post-Translational Modification