| UniProt ID | NHP6_SCHPO | |
|---|---|---|
| UniProt AC | P87057 | |
| Protein Name | Non-histone chromosomal protein 6 | |
| Gene Name | nhp6 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 108 | |
| Subcellular Localization | Nucleus . Chromosome. | |
| Protein Description | DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex (By similarity).. | |
| Protein Sequence | MPRAAKSSRKKDPNTPKRNMSAFMFFSIENREKMKTDNPDATFGQLGSLLGKRWKELTSTEREPYEEKARQDKERYERERKEYDTKLANGEKTGKASAPAAAAAAKEE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of NHP6_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NHP6_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NHP6_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NHP6_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SPC34_SCHPO | spc34 | genetic | 18818364 | |
| ABP1_SCHPO | cbp1 | genetic | 18818364 | |
| MAD1_SCHPO | mad1 | genetic | 18818364 | |
| MPH1L_SCHPO | mph1 | genetic | 22681890 | |
| REB1_SCHPO | reb1 | genetic | 22681890 | |
| YEG5_SCHPO | mga2 | genetic | 22681890 | |
| HIS4_SCHPO | SPAC3F10.09 | genetic | 22681890 | |
| CTBL1_SCHPO | SPAC1952.06c | genetic | 22681890 | |
| MUG33_SCHPO | mug33 | genetic | 22681890 | |
| RIA1_SCHPO | ria1 | genetic | 22681890 | |
| AROG_SCHPO | SPAP8A3.07c | genetic | 22681890 | |
| CYSK_SCHPO | cys11 | genetic | 22681890 | |
| RL16B_SCHPO | rpl1601 | genetic | 22681890 | |
| YETC_SCHPO | SPAC8C9.12c | genetic | 22681890 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
