UniProt ID | VRP1_SCHPO | |
---|---|---|
UniProt AC | Q9P6R1 | |
Protein Name | Verprolin {ECO:0000312|EMBL:CAB89884.1} | |
Gene Name | vrp1 {ECO:0000312|EMBL:CAB89884.1} | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 309 | |
Subcellular Localization | Cytoplasm, cytoskeleton . Localized to patches at the tips of growing interphase cells. These patches form prior to patches of myo1, but in cells lacking myo1, they are less intense and may be short lived. Detected in the medial region of mitotic cel | |
Protein Description | Involved in cytoskeletal organization and cellular growth. May exert its effects on the cytoskeleton directly, or indirectly via proline-binding proteins such as profilin or proteins possessing SH3 domains. Plays a role in actin patch assembly by enhancing the ability of myo1 to stimulate actin polymerization by the Arp2/3 complex.. | |
Protein Sequence | MAPAPPPPPPAPAPAAAAPAPPLMTGDRSALLNSIQKGKKLKKATTNDRSAPVVGGGVVGERKSNTPKSFAAPPVPTGAPSLPTSSNNTQQAEERPSMPALGGLFAGGMPKLRHIGKSSASAAPPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAPVANTSSRPSSFAPPAGHAPNVTSESPKFPNRGPSIPSASVPPVPPSSYVLQQRPNRVDDHGRFHFKDDSYLPIPHPFLGVPKVYRGGSGTTVPLNLSSF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | Phosphorylation | GKKLKKATTNDRSAP CCCCCCCCCCCCCCC | 34.70 | 24763107 | |
153 | Phosphorylation | RPSIPPPSPASAPPI CCCCCCCCCCCCCCC | 38.58 | 29996109 | |
156 | Phosphorylation | IPPPSPASAPPIPSK CCCCCCCCCCCCCCC | 44.70 | 29996109 | |
183 | Phosphorylation | QPAAPVKSPPSAPSL CCCCCCCCCCCCCCC | 42.13 | 27738172 | |
214 | Phosphorylation | SQAPVANTSSRPSSF HHCCCCCCCCCCHHC | 20.52 | 21712547 | |
215 | Phosphorylation | QAPVANTSSRPSSFA HCCCCCCCCCCHHCC | 24.94 | 21712547 | |
220 | Phosphorylation | NTSSRPSSFAPPAGH CCCCCCHHCCCCCCC | 28.27 | 27738172 | |
232 | Phosphorylation | AGHAPNVTSESPKFP CCCCCCCCCCCCCCC | 33.16 | 29996109 | |
233 | Phosphorylation | GHAPNVTSESPKFPN CCCCCCCCCCCCCCC | 31.62 | 29996109 | |
235 | Phosphorylation | APNVTSESPKFPNRG CCCCCCCCCCCCCCC | 32.91 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VRP1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VRP1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VRP1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...