UniProt ID | ADN1_SCHPO | |
---|---|---|
UniProt AC | O74364 | |
Protein Name | Adhesion defective protein 1 | |
Gene Name | adn1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 391 | |
Subcellular Localization | Nucleus . | |
Protein Description | Probable transcriptional regulator involved in cell adhesion.. | |
Protein Sequence | MVANYASMMYHNGSNILGYGVLRLLQYNEQLMSGWESTMKDDIGYWRRFVHDFYTEKGTFRYNIDYKDSPNQEPKLFELSYAALPRFLYLSYCGKLKKMSFLLGNTKEFAIPNNGYFVESSRASILYQYQGGVQVIVSGHLRAHFFRAPLLKLDSLEFSAVGHSEYLLRELMTNASLALSQSRPPQNQIQHDGVKSEDPSSESVNINSSSSLLPDSPVNEYGLEPHIMRFMEITETISGMRDLIAFTLAQRSGPTSALHKFATALQQQHQMQKSTSSNIPYANPAPSGFNGSPRNGDVASLASNYRYAKQPPTMPANAISQANRLLDQNNIPNMDPSILPQSMPIASVPPYSLQGIKRQGTHSPMVEGENPNNNPNFYSSDMLNAQKRTKV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
287 | Phosphorylation | PYANPAPSGFNGSPR CCCCCCCCCCCCCCC | 59.11 | 29996109 | |
292 | Phosphorylation | APSGFNGSPRNGDVA CCCCCCCCCCCCCHH | 23.07 | 28889911 | |
361 | Phosphorylation | QGIKRQGTHSPMVEG CCCCCCCCCCCCCCC | 15.73 | 24763107 | |
363 | Phosphorylation | IKRQGTHSPMVEGEN CCCCCCCCCCCCCCC | 17.96 | 21712547 | |
378 | Phosphorylation | PNNNPNFYSSDMLNA CCCCCCCCCHHHHHH | 17.57 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ADN1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ADN1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ADN1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ADN1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...