| UniProt ID | ADN1_SCHPO | |
|---|---|---|
| UniProt AC | O74364 | |
| Protein Name | Adhesion defective protein 1 | |
| Gene Name | adn1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 391 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Probable transcriptional regulator involved in cell adhesion.. | |
| Protein Sequence | MVANYASMMYHNGSNILGYGVLRLLQYNEQLMSGWESTMKDDIGYWRRFVHDFYTEKGTFRYNIDYKDSPNQEPKLFELSYAALPRFLYLSYCGKLKKMSFLLGNTKEFAIPNNGYFVESSRASILYQYQGGVQVIVSGHLRAHFFRAPLLKLDSLEFSAVGHSEYLLRELMTNASLALSQSRPPQNQIQHDGVKSEDPSSESVNINSSSSLLPDSPVNEYGLEPHIMRFMEITETISGMRDLIAFTLAQRSGPTSALHKFATALQQQHQMQKSTSSNIPYANPAPSGFNGSPRNGDVASLASNYRYAKQPPTMPANAISQANRLLDQNNIPNMDPSILPQSMPIASVPPYSLQGIKRQGTHSPMVEGENPNNNPNFYSSDMLNAQKRTKV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 287 | Phosphorylation | PYANPAPSGFNGSPR CCCCCCCCCCCCCCC | 59.11 | 29996109 | |
| 292 | Phosphorylation | APSGFNGSPRNGDVA CCCCCCCCCCCCCHH | 23.07 | 28889911 | |
| 361 | Phosphorylation | QGIKRQGTHSPMVEG CCCCCCCCCCCCCCC | 15.73 | 24763107 | |
| 363 | Phosphorylation | IKRQGTHSPMVEGEN CCCCCCCCCCCCCCC | 17.96 | 21712547 | |
| 378 | Phosphorylation | PNNNPNFYSSDMLNA CCCCCCCCCHHHHHH | 17.57 | 21712547 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ADN1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ADN1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ADN1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ADN1_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...