ADN1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ADN1_SCHPO
• UniProt AC: O74364
• Protein Name: Adhesion defective protein 1
• Gene Name: adn1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 391
• Subcellular Localization: Nucleus .
• Protein Description: Probable transcriptional regulator involved in cell adhesion..
• Protein Sequence: MVANYASMMYHNGSNILGYGVLRLLQYNEQLMSGWESTMKDDIGYWRRFVHDFYTEKGTFRYNIDYKDSPNQEPKLFELSYAALPRFLYLSYCGKLKKMSFLLGNTKEFAIPNNGYFVESSRASILYQYQGGVQVIVSGHLRAHFFRAPLLKLDSLEFSAVGHSEYLLRELMTNASLALSQSRPPQNQIQHDGVKSEDPSSESVNINSSSSLLPDSPVNEYGLEPHIMRFMEITETISGMRDLIAFTLAQRSGPTSALHKFATALQQQHQMQKSTSSNIPYANPAPSGFNGSPRNGDVASLASNYRYAKQPPTMPANAISQANRLLDQNNIPNMDPSILPQSMPIASVPPYSLQGIKRQGTHSPMVEGENPNNNPNFYSSDMLNAQKRTKV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
287	Phosphorylation	PYANPAPSGFNGSPR CCCCCCCCCCCCCCC	59.11	29996109
292	Phosphorylation	APSGFNGSPRNGDVA CCCCCCCCCCCCCHH	23.07	28889911
361	Phosphorylation	QGIKRQGTHSPMVEG CCCCCCCCCCCCCCC	15.73	24763107
363	Phosphorylation	IKRQGTHSPMVEGEN CCCCCCCCCCCCCCC	17.96	21712547
378	Phosphorylation	PNNNPNFYSSDMLNA CCCCCCCCCHHHHHH	17.57	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ADN1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ADN1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ADN1_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of ADN1_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.