| UniProt ID | RHO2_SCHPO | |
|---|---|---|
| UniProt AC | Q10133 | |
| Protein Name | GTP-binding protein rho2 | |
| Gene Name | rho2 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 200 | |
| Subcellular Localization |
Cell membrane Lipid-anchor . Found at the growing tips of interphase cells and at the septum prior to cytokinesis. |
|
| Protein Description | Involved in cell morphogenesis, the maintenance of growth direction, control of polarity and of cell wall integrity. Regulates the synthesis of alpha-D-glucan through activation of pck2.. | |
| Protein Sequence | MLQSQPIRRKLVVVGDGACGKTSLLSVFTLGYFPTEYVPTVFENYVSDCRVDGKSVQLALWDTAGQEEYERLRPMSYAKAHIILVGFAIDSPDSLENVSTKWIEEINTLCPNVPFILVGMKADLRSDPVAIEEMRRRNQNFVKSQQAELVAQRIGARKYMECSSLTGDGVDDVFEAATRAALTVRDSENDKSSTKCCIIS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 196 | S-palmitoylation | NDKSSTKCCIIS--- CCCCCCEEEEEC--- | 1.72 | 28729673 | |
| 197 | Methylation | DKSSTKCCIIS---- CCCCCEEEEEC---- | 3.10 | - | |
| 197 | Geranylgeranylation | DKSSTKCCIIS---- CCCCCEEEEEC---- | 3.10 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHO2_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHO2_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHO2_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PCK2_SCHPO | pck2 | genetic | 11102532 | |
| PCK1_SCHPO | pck1 | genetic | 17005909 | |
| SPM1_SCHPO | pmk1 | genetic | 17005909 | |
| SKH1_SCHPO | pek1 | genetic | 17005909 | |
| MKH1_SCHPO | mkh1 | genetic | 17005909 | |
| PCK2_SCHPO | pck2 | physical | 18793338 | |
| SCD1_SCHPO | scd1 | physical | 14637153 | |
| RGA4_SCHPO | rga4 | physical | 20164182 | |
| RGA7_SCHPO | rga7 | genetic | 20164182 | |
| PCK2_SCHPO | pck2 | genetic | 17005909 | |
| GDIR_SCHPO | SPAC6F12.06 | genetic | 24820419 | |
| RHO3_SCHPO | rho3 | genetic | 24820419 | |
| ERFB_SCHPO | erf2 | genetic | 24820419 | |
| RHO1_SCHPO | rho1 | genetic | 24498240 | |
| PCK1_SCHPO | pck1 | genetic | 24498240 | |
| PMP1_SCHPO | pmp1 | genetic | 27451356 | |
| SKB5_SCHPO | skb5 | genetic | 27451356 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
