dbPTM

RHO1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RHO1_SCHPO
UniProt AC	Q09914
Protein Name	GTP-binding protein rho1
Gene Name	rho1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	202
Subcellular Localization	Cell membrane Lipid-anchor . Found at the growing tips of interphase cells and at the septum prior to cytokinesis.
Protein Description	Involved in the regulation of cell wall growth and actin cytoskeleton organization. Activates (1,3)-beta-D-glucan synthase..
Protein Sequence	MATELRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGRHVELALWDTAGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEVLHFCSSLPILLVACKADLRNDPKIIEELSKTNQHPVTTEEGQAVAQKIGAYKYLECSAKTNEGVREVFESATRAAMLKHKPKVKPSSGTKKKKRCILL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
199	Methylation	GTKKKKRCILL---- CCCCCCEEEEC----	3.36	-
199	Geranylgeranylation	GTKKKKRCILL---- CCCCCCEEEEC----	3.36	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RHO1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RHO1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RHO1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RHO5_SCHPO	rho5	genetic	16524899
RGA8_SCHPO	rga8	genetic	14506270
RHO5_SCHPO	rho5	genetic	16146630
RGA1_SCHPO	rga1	physical	11737264
PCK1_SCHPO	pck1	physical	10504305
RGF3_SCHPO	rgf3	physical	15546915
RGF1_SCHPO	rgf1	physical	16324155
RGF2_SCHPO	rgf2	physical	16324155
RGF1_SCHPO	rgf1	physical	16421249
RGF1_SCHPO	rgf1	physical	14637153
SCD1_SCHPO	scd1	physical	14637153
RGA5_SCHPO	rga5	genetic	12519200
RGA1_SCHPO	rga1	genetic	11737264
PCK2_SCHPO	pck2	genetic	10651902
SPM1_SCHPO	pmk1	genetic	23934882
RHO2_SCHPO	rho2	genetic	23934882
PCK1_SCHPO	pck1	genetic	24498240
RHO2_SCHPO	rho2	genetic	24498240

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RHO1_SCHPO

Related Literatures of Post-Translational Modification