UniProt ID | RHO1_SCHPO | |
---|---|---|
UniProt AC | Q09914 | |
Protein Name | GTP-binding protein rho1 | |
Gene Name | rho1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 202 | |
Subcellular Localization |
Cell membrane Lipid-anchor . Found at the growing tips of interphase cells and at the septum prior to cytokinesis. |
|
Protein Description | Involved in the regulation of cell wall growth and actin cytoskeleton organization. Activates (1,3)-beta-D-glucan synthase.. | |
Protein Sequence | MATELRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGRHVELALWDTAGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEVLHFCSSLPILLVACKADLRNDPKIIEELSKTNQHPVTTEEGQAVAQKIGAYKYLECSAKTNEGVREVFESATRAAMLKHKPKVKPSSGTKKKKRCILL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RHO1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RHO1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RHO1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RHO5_SCHPO | rho5 | genetic | 16524899 | |
RGA8_SCHPO | rga8 | genetic | 14506270 | |
RHO5_SCHPO | rho5 | genetic | 16146630 | |
RGA1_SCHPO | rga1 | physical | 11737264 | |
PCK1_SCHPO | pck1 | physical | 10504305 | |
RGF3_SCHPO | rgf3 | physical | 15546915 | |
RGF1_SCHPO | rgf1 | physical | 16324155 | |
RGF2_SCHPO | rgf2 | physical | 16324155 | |
RGF1_SCHPO | rgf1 | physical | 16421249 | |
RGF1_SCHPO | rgf1 | physical | 14637153 | |
SCD1_SCHPO | scd1 | physical | 14637153 | |
RGA5_SCHPO | rga5 | genetic | 12519200 | |
RGA1_SCHPO | rga1 | genetic | 11737264 | |
PCK2_SCHPO | pck2 | genetic | 10651902 | |
SPM1_SCHPO | pmk1 | genetic | 23934882 | |
RHO2_SCHPO | rho2 | genetic | 23934882 | |
PCK1_SCHPO | pck1 | genetic | 24498240 | |
RHO2_SCHPO | rho2 | genetic | 24498240 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...