RHO5_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RHO5_SCHPO
• UniProt AC: Q9HE04
• Protein Name: GTP-binding protein rho5
• Gene Name: rho5
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 200
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Sequence: MTTELRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGRHIELALWDTAGQEDYDRLRPLSYPDSHVVLICFSVDAPESLDNVQEKWISEVLHFCSNLPILLVGCKVDLRNDPKTIEELSKTSQKPITFEEGQVVAQKIGAYKYLECSAKLNEGVNEVFETAARASMLKFKPASVPKTKKKKHCILL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
197	Methylation	KTKKKKHCILL---- CCCCCCCEEEC----	3.01	-
197	Geranylgeranylation	KTKKKKHCILL---- CCCCCCCEEEC----	3.01	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RHO5_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RHO5_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RHO5_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RGF1_SCHPO	rgf1	physical	14637153
SCD1_SCHPO	scd1	physical	14637153

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.