UniProt ID | GDIR_SCHPO | |
---|---|---|
UniProt AC | O14224 | |
Protein Name | Rho GDP-dissociation inhibitor | |
Gene Name | SPAC6F12.06 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 205 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.. | |
Protein Sequence | MSVNNEVSADQHNPELEDDTFEHGPPVSLGEKKSLNEYMKMDAEDESLQKWKASLGITGTGYSPSNDRRTVVILKLSLLVDGRDPVDVNMEDAASVEQIRKKGFTIKEGSEFKIGVKFRVQHEVISGLRYVQTVRRRGFVVDKTSTMIGSYGPSETPYDFTSEPDEAPTGMLARGHYEANGKFVDDDKVVHHEFVWAFDVAKSWK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSVNNEVSA ------CCCCCCCCC | 33.29 | 24763107 | |
8 | Phosphorylation | MSVNNEVSADQHNPE CCCCCCCCCCCCCCC | 21.68 | 29996109 | |
20 | Phosphorylation | NPELEDDTFEHGPPV CCCCCCCCCCCCCCC | 43.15 | 29996109 | |
28 | Phosphorylation | FEHGPPVSLGEKKSL CCCCCCCCCCCCCCH | 36.11 | 29996109 | |
34 | Phosphorylation | VSLGEKKSLNEYMKM CCCCCCCCHHHHHCC | 47.71 | 19547744 | |
63 | Phosphorylation | GITGTGYSPSNDRRT CCCCCCCCCCCCCCE | 24.17 | 28889911 | |
65 | Phosphorylation | TGTGYSPSNDRRTVV CCCCCCCCCCCCEEE | 45.48 | 19547744 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GDIR_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GDIR_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GDIR_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PST2_SCHPO | pst2 | genetic | 19547744 | |
ABP1_SCHPO | cbp1 | genetic | 18818364 | |
ZRG17_SCHPO | zrg17 | genetic | 22681890 | |
RIA1_SCHPO | ria1 | genetic | 22681890 | |
SGF29_SCHPO | sgf29 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...