MU185_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MU185_SCHPO
• UniProt AC: O14213
• Protein Name: Meiotically up-regulated gene 185 protein
• Gene Name: mug185
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 380
• Subcellular Localization: Endoplasmic reticulum .
• Protein Description: Has a role in meiosis..
• Protein Sequence: MNNPFKDMDCYEILQVNHDSDLQEIKANYRKLALQYHPDRNPGIEDYNEIFSQINAAYNILSNDDKRKWHEKDYLRNQYSVQIEDVLQHLQTIEKIPFESTSAFVERLRQDEKIAGSTDDLPTLGDTTWLWTYAKPIYQKWLRFSTKKSFEWEALYNEEEESDAATRRLMKRQNQRQIQYCIQRYNELVRDLIGKACDLDPRRKNVVKLSDGERYNSLQEASRKQSERDRRQYQETFKNQSIASWTIIDQEETSSDDESLSKEIVNSNPIMCMVCNKNFRSQNQLENHENSKKHKKNLRKMNQEIKKHAKEAQKNAESNKQPEDAPSESPYSNKVSSSDFYTRSFEEIEKTFTFVEISDNEFYTASEDGFLNEDDKLDQD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of MU185_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MU185_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MU185_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MU185_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GOS1_SCHPO	gos1	genetic	22681890
VPS38_SCHPO	vps38	genetic	22681890
RM01_SCHPO	SPAC1610.02c	genetic	22681890
SAT1_SCHPO	sat1	genetic	22681890
SHF1_SCHPO	shf1	genetic	22681890
AREH2_SCHPO	are2	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.