| UniProt ID | REP2_SCHPO | |
|---|---|---|
| UniProt AC | Q09824 | |
| Protein Name | Transcriptional activator protein rep2 | |
| Gene Name | rep2 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 219 | |
| Subcellular Localization | ||
| Protein Description | Transcriptional activator which interacts with the mcb binding subunit complex formed by res2 and cdc10. Rep2 is required for the mitotic cell cycle start.. | |
| Protein Sequence | MHFADIPLSKPCLNNPPTYPWSSPILSSIANPSLCDIVSSPSSVSSFASSDDFAFMNAYCLPIQQNHQFGSPVAASPNQQPLVESQNRRNVTYASLVIGKLGIAQLIRQQTDPPQIIHRKQDKGLMARVLSRSKKQEERENHSSDARDAIKSALRRRMRRREGRVQKALRPTPNLICSKCNTTFNHSTALMMHEATCLNQVPFKLSDFFVEDVIDDWLF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of REP2_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of REP2_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of REP2_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of REP2_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RES2_SCHPO | res2 | physical | 9614195 | |
| RES1_SCHPO | res1 | physical | 9614195 | |
| CGP1_SCHPO | pas1 | genetic | 10982385 | |
| RES2_SCHPO | res2 | genetic | 10982385 | |
| RES1_SCHPO | res1 | genetic | 8970158 | |
| RES1_SCHPO | res1 | physical | 8970158 | |
| RES2_SCHPO | res2 | physical | 8970158 | |
| REC16_SCHPO | rep1 | genetic | 7588609 | |
| RES1_SCHPO | res1 | genetic | 7588609 | |
| RES2_SCHPO | res2 | genetic | 7588609 | |
| RES2_SCHPO | res2 | physical | 7588609 | |
| RES1_SCHPO | res1 | physical | 7588609 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
