UniProt ID | PPIB_SCHPO | |
---|---|---|
UniProt AC | O94273 | |
Protein Name | Peptidyl-prolyl cis-trans isomerase B | |
Gene Name | cyp4 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 201 | |
Subcellular Localization | Endoplasmic reticulum lumen . | |
Protein Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).. | |
Protein Sequence | MKLFYFSLLFTLFFGLISANRGPKVTDTVYFDLQQGDEFLGRVTIGLFGKTVPKTAENFRALATGEKGFGYEGSIFHRVIPNFMIQGGDITKGDGTGGKSIYGSRFPDENFKLSHQRPGLLSMANAGPDSNGSQFFITTVKTPWLDGHHVVFGEVLSGYDIVKKISKAETDNRDKPLEDVKIIKSGQLSQENVEDDGTDEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPIB_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPIB_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPIB_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CCR4_SCHPO | ccr4 | genetic | 18818364 | |
ALG8_SCHPO | alg8 | genetic | 22681890 | |
PLR2_SCHPO | SPCC1281.04 | genetic | 22681890 | |
YEG5_SCHPO | mga2 | genetic | 22681890 | |
MYO51_SCHPO | myo51 | genetic | 22681890 | |
NDK_SCHPO | ndk1 | genetic | 22681890 | |
ALG6_SCHPO | alg6 | genetic | 22681890 | |
ARP42_SCHPO | arp42 | genetic | 22681890 | |
MSC1_SCHPO | msc1 | genetic | 22681890 | |
YJD1_SCHPO | SPCC594.01 | genetic | 22681890 | |
VPS3_SCHPO | vps3 | genetic | 22681890 | |
ATP11_SCHPO | atp11 | genetic | 22681890 | |
PPK16_SCHPO | ppk16 | genetic | 22681890 | |
TOM70_SCHPO | tom70 | genetic | 22681890 | |
FFT3_SCHPO | fft3 | genetic | 22681890 | |
ASE1_SCHPO | ase1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...