| UniProt ID | PPIB_SCHPO | |
|---|---|---|
| UniProt AC | O94273 | |
| Protein Name | Peptidyl-prolyl cis-trans isomerase B | |
| Gene Name | cyp4 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 201 | |
| Subcellular Localization | Endoplasmic reticulum lumen . | |
| Protein Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).. | |
| Protein Sequence | MKLFYFSLLFTLFFGLISANRGPKVTDTVYFDLQQGDEFLGRVTIGLFGKTVPKTAENFRALATGEKGFGYEGSIFHRVIPNFMIQGGDITKGDGTGGKSIYGSRFPDENFKLSHQRPGLLSMANAGPDSNGSQFFITTVKTPWLDGHHVVFGEVLSGYDIVKKISKAETDNRDKPLEDVKIIKSGQLSQENVEDDGTDEL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPIB_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPIB_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPIB_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CCR4_SCHPO | ccr4 | genetic | 18818364 | |
| ALG8_SCHPO | alg8 | genetic | 22681890 | |
| PLR2_SCHPO | SPCC1281.04 | genetic | 22681890 | |
| YEG5_SCHPO | mga2 | genetic | 22681890 | |
| MYO51_SCHPO | myo51 | genetic | 22681890 | |
| NDK_SCHPO | ndk1 | genetic | 22681890 | |
| ALG6_SCHPO | alg6 | genetic | 22681890 | |
| ARP42_SCHPO | arp42 | genetic | 22681890 | |
| MSC1_SCHPO | msc1 | genetic | 22681890 | |
| YJD1_SCHPO | SPCC594.01 | genetic | 22681890 | |
| VPS3_SCHPO | vps3 | genetic | 22681890 | |
| ATP11_SCHPO | atp11 | genetic | 22681890 | |
| PPK16_SCHPO | ppk16 | genetic | 22681890 | |
| TOM70_SCHPO | tom70 | genetic | 22681890 | |
| FFT3_SCHPO | fft3 | genetic | 22681890 | |
| ASE1_SCHPO | ase1 | genetic | 22681890 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...