UniProt ID | NDK_SCHPO | |
---|---|---|
UniProt AC | P49740 | |
Protein Name | Nucleoside diphosphate kinase | |
Gene Name | ndk1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 151 | |
Subcellular Localization | ||
Protein Description | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.. | |
Protein Sequence | MSTEQTFIAVKPDAVQRGLIGYIISKFELKGYKLRALKFLVPSRDLVEEHYAEHKGKPFYEKLVGFMASGPVCAMIWEGKQAVKTGRLMLGASNPLDSAPGTIRGDYGIDLGRNVCHGSDSIESANREIKLWFQPSEIQVYDRTIEPWIYE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
136 | Phosphorylation | IKLWFQPSEIQVYDR EEEEECCCCEEEEEE | 36.23 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDK_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDK_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDK_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MUB1_SCHPO | SPBC31F10.10c | genetic | 18818364 | |
DDB1_SCHPO | ddb1 | genetic | 22681890 | |
REB1_SCHPO | reb1 | genetic | 22681890 | |
VAM7_SCHPO | SPCC594.06c | genetic | 22681890 | |
MSA1_SCHPO | msa1 | genetic | 22681890 | |
MFH2_SCHPO | fml2 | genetic | 22681890 | |
RAD57_SCHPO | rad57 | genetic | 22681890 | |
ZFS1_SCHPO | zfs1 | genetic | 22681890 | |
SSN3_SCHPO | srb10 | genetic | 22681890 | |
PPIB_SCHPO | cyp4 | genetic | 22681890 | |
CYB51_SCHPO | SPBC29A10.16c | genetic | 22681890 | |
YII1_SCHPO | SPAC139.01c | genetic | 22681890 | |
YDFB_SCHPO | SPAC17C9.11c | genetic | 22681890 | |
YHAG_SCHPO | saw1 | genetic | 22681890 | |
FFT3_SCHPO | fft3 | genetic | 22681890 | |
TRM6_SCHPO | gcd10 | genetic | 22681890 | |
UBP2_SCHPO | ubp2 | genetic | 22681890 | |
NDK_SCHPO | ndk1 | physical | 23695164 | |
NDK_SCHPO | ndk1 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...