YHAG_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YHAG_SCHPO
• UniProt AC: Q9UUA8
• Protein Name: Uncharacterized protein C409.16c
• Gene Name: SPBC409.16c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 120
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Sequence: MCSVEKIVRLRHNLLCHVRIHFKTKEDLDIRAFLFSLQRELHAVAFLNQGSIRTLYEKRVVDITSESVQSHAIIETARNFALPNTAEEEENMDRKPELQLSFKGSMTSKIIHIYVQPFDS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YHAG_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YHAG_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YHAG_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YHAG_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RAD16_SCHPO	rad16	physical	25203555
SWI10_SCHPO	swi10	physical	25203555
DNA2_SCHPO	dna2	physical	25203555
CDC24_SCHPO	cdc24	physical	25203555
YCD2_SCHPO	pxd1	physical	25203555
RAD16_SCHPO	rad16	physical	25777942
SWI10_SCHPO	swi10	physical	25777942
YCD2_SCHPO	pxd1	physical	25777942

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.