| UniProt ID | DRE4_SCHPO | |
|---|---|---|
| UniProt AC | Q09685 | |
| Protein Name | Pre-mRNA-splicing factor dre4 | |
| Gene Name | dre4 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 411 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of the spliceosome involved in mRNA processing.. | |
| Protein Sequence | MSQPLPPGWTEHKAPSGIPYYWNAELKKSTYQRPSFIEKNHSSSVTASQASLAFNTSEKLFVNENAEERKNSRDLRKQLPDRPKFKKRIPNNDSWVVVFTKKNRYFFHNLKSHESYWEPPLEISKDLKILRLPIRKQISKDSSQSQNVDSGKTNHEEIHESRHLQTEIEEPSGLEESSEESVLYSEEFYEKSDEEEDEEKSHSAEELEFGEEDIMYQLQQLDDETVSYDIQEQATNLSTDDARRVFTELLKDKNIGAYQPWELVYPKLLDDDRFYVLDSGERRKEVFEEYCKSVVSTKKITRRKNTLSDFWTLLHSLPSTLLWPQFKRKYRKSSTLQIPGYSERDFEKLFREFQILRKQPMQDKLLNFKKLCKSKTVDPKNPDEFTESILNDTRYAVLTREELDSLACSSN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DRE4_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DRE4_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DRE4_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...