dbPTM

DRE4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DRE4_SCHPO
UniProt AC	Q09685
Protein Name	Pre-mRNA-splicing factor dre4
Gene Name	dre4
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	411
Subcellular Localization	Nucleus .
Protein Description	Component of the spliceosome involved in mRNA processing..
Protein Sequence	MSQPLPPGWTEHKAPSGIPYYWNAELKKSTYQRPSFIEKNHSSSVTASQASLAFNTSEKLFVNENAEERKNSRDLRKQLPDRPKFKKRIPNNDSWVVVFTKKNRYFFHNLKSHESYWEPPLEISKDLKILRLPIRKQISKDSSQSQNVDSGKTNHEEIHESRHLQTEIEEPSGLEESSEESVLYSEEFYEKSDEEEDEEKSHSAEELEFGEEDIMYQLQQLDDETVSYDIQEQATNLSTDDARRVFTELLKDKNIGAYQPWELVYPKLLDDDRFYVLDSGERRKEVFEEYCKSVVSTKKITRRKNTLSDFWTLLHSLPSTLLWPQFKRKYRKSSTLQIPGYSERDFEKLFREFQILRKQPMQDKLLNFKKLCKSKTVDPKNPDEFTESILNDTRYAVLTREELDSLACSSN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
388	Phosphorylation	NPDEFTESILNDTRY CHHHHHHHHHHCCCE	29.35	25720772
410	Phosphorylation	LDSLACSSN------ HHHHHHCCC------	46.58	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DRE4_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DRE4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DRE4_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRP19_SCHPO	prp19	physical	21386897
DRE4_SCHPO	dre4	physical	21386897
SAF1_SCHPO	saf1	physical	21386897
RSMB_SCHPO	smb1	physical	21386897
SAP62_SCHPO	sap62	physical	21386897
YERE_SCHPO	saf2	physical	21386897
CWC26_SCHPO	cwf26	physical	21386897
SMD1_SCHPO	smd1	physical	21386897
SN114_SCHPO	cwf10	physical	21386897
YLK3_SCHPO	saf3	physical	21386897
SA114_SCHPO	sap114	physical	21386897
IST3_SCHPO	cwf29	physical	21386897
SPP42_SCHPO	spp42	physical	21386897
SA145_SCHPO	sap145	physical	21386897
RSD1_SCHPO	rsd1	physical	21386897
PRP46_SCHPO	prp5	physical	21386897
SAP61_SCHPO	sap61	physical	21386897
PRP38_SCHPO	prp38	physical	21386897
SF3B1_SCHPO	prp10	physical	21386897
RSE1_SCHPO	prp12	physical	21386897
SMD3_SCHPO	smd3	physical	21386897
CWC15_SCHPO	cwf15	physical	21386897
RU2A_SCHPO	lea1	physical	21386897
BRR2_SCHPO	brr2	physical	21386897
CWF17_SCHPO	spf38	physical	21386897
U2AF2_SCHPO	prp2	physical	21386897
CLF1_SCHPO	cwf4	physical	21386897
RUXG_SCHPO	smg1	physical	21386897
SYF1_SCHPO	cwf3	physical	21386897
MUG64_SCHPO	mug64	physical	21386897
CWF11_SCHPO	cwf11	physical	21386897
PRP17_SCHPO	prp17	physical	21386897
CWC2_SCHPO	cwf2	physical	21386897
PRP45_SCHPO	prp45	physical	21386897
CEF1_SCHPO	cdc5	physical	21386897
SPF27_SCHPO	cwf7	physical	21386897
SLT11_SCHPO	cwf5	physical	21386897
CEF1_SCHPO	cdc5	genetic	21386897
YERE_SCHPO	saf2	physical	26771498
SAF1_SCHPO	saf1	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DRE4_SCHPO

Related Literatures of Post-Translational Modification