PRP38_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PRP38_SCHPO
• UniProt AC: Q9UUD2
• Protein Name: Pre-mRNA-splicing factor 38
• Gene Name: prp38 {ECO:0000312|EMBL:CAB52035.1}
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 210
• Subcellular Localization: Nucleus .
• Protein Description: Required for pre-mRNA splicing and maintenance of stable U6 small nuclear RNA levels. Implicated in the formation of stable and biologically active snRNP structures. As part of the U4/U6.U5 tri-snRNP particle, dispensible for spliceosome assembly, but required for conformational changes, which result in U4 snRNA release and the subsequent catalytic activation of the spliceosome (By similarity)..
• Protein Sequence: MADFLARDYRSQGEAAHEMLPTFLIGKILRERIVDSIYWKEQCFGLNACSLVDRAVRLEYIGGQYGNQRPTEFICLLYKLLQIAPEKEIIQQYLSIPEFKYLRALAAFYVRLTWDDVEVHQTLEPLLRDYRKLRIRTNSEIRLTYLDEVVDDLLNAEVVCDISLPPLRSRLQLEDLDLLEPLSSSSDEEDDDEEQISKLESNEGAVDRNI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PRP38_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PRP38_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PRP38_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PRP38_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CTBL1_SCHPO	SPAC1952.06c	genetic	22681890
ARGJ_SCHPO	SPBC1271.14	genetic	22681890
OTC_SCHPO	arg3	genetic	22681890
NAGS_SCHPO	arg6	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.