UniProt ID | FKBPH_SCHPO | |
---|---|---|
UniProt AC | Q10175 | |
Protein Name | Probable peptidyl-prolyl cis-trans isomerase C27F1.06c | |
Gene Name | SPAC27F1.06c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 362 | |
Subcellular Localization | ||
Protein Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).. | |
Protein Sequence | MSKEETLYSVKVDQERVPLFDEDFYKGFRSELSVRFTMAALDPRAKSNDAVTVNVITRLEHPEEDGEESDEELFQEEKFTLCTLKKGSVYQQPIDIIFSPGEEVFFERVGGDIPVYLSGTCIITNIPEEEDSSDLENDFLYGADEFSSDEEEMDDISVTSSEEEEEENGARIEELNSDEEDAEQAEEEILEKPVPKDEVAEKHSKDKLKKEEKEKKTAVDVSDSVNGKKRKTEPAGEGEQTEKKSKSTKTYPKQVLEGNVTVQDKVKGDGPAAKRKKRVSMRYIGRLTNGKVFDKNITGKPFTFNLGLEEVIKGWDVGIVGMQVGGERTIHIPAAMAYGSKRLPGIPANSDLVFDVKLLAVN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Phosphorylation | DFYKGFRSELSVRFT HHHHCHHHHHHHEEE | 40.40 | 25720772 | |
47 | Phosphorylation | ALDPRAKSNDAVTVN CCCCCCCCCCCEEEE | 38.67 | 21712547 | |
57 | Phosphorylation | AVTVNVITRLEHPEE CEEEEEEEECCCCCC | 25.56 | 21712547 | |
69 | Phosphorylation | PEEDGEESDEELFQE CCCCCCCCHHHHHHH | 46.12 | 28889911 | |
177 | Phosphorylation | ARIEELNSDEEDAEQ CCHHHHCCCHHHHHH | 60.05 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKBPH_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKBPH_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKBPH_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
POM1_SCHPO | pom1 | genetic | 18818364 | |
TAS3_SCHPO | tas3 | genetic | 18818364 | |
PEF1_SCHPO | pef1 | genetic | 18818364 | |
CID12_SCHPO | cid12 | genetic | 18818364 | |
SDS23_SCHPO | sds23 | genetic | 22681890 | |
PLB2_SCHPO | SPAC1A6.03c | genetic | 22681890 | |
CYB51_SCHPO | SPBC29A10.16c | genetic | 22681890 | |
MUG73_SCHPO | mug73 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...