dbPTM

TR112_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TR112_SCHPO
UniProt AC	Q09723
Protein Name	Multifunctional methyltransferase subunit trm112
Gene Name	trm112
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	126
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Acts as an activator of both rRNA/tRNA and protein methyltransferases. Together with methyltransferase mtq2, required for the methylation of eRF1 on 'Gln-182'. Together with methyltransferase trm11, required for the formation of 2-methylguanosine at position 10 (m2G10) in tRNA. Together with methyltransferase bud23, required for the formation of a 7-methylguanine in 18S rRNA. Involved in biogenesis of both 40S and 60S ribosomal subunits (By similarity)..
Protein Sequence	MKLLTANFLNCSNKKCTSSPEAFPLDVVDAKLAIQQLELKPEFLIGIMPRIDWNALLKTTRQLGNYSLPDEKPDLVDDSDEVLLKSLHNVLLETEITEGKMVCGNCGHVYPIFEGIPNMLLSESEI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
122	Phosphorylation	GIPNMLLSESEI--- CCCCHHCCCCCC---	34.81	29996109
124	Phosphorylation	PNMLLSESEI----- CCHHCCCCCC-----	36.90	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TR112_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TR112_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TR112_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of TR112_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TR112_SCHPO

Related Literatures of Post-Translational Modification