STE4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: STE4_SCHPO
• UniProt AC: P36622
• Protein Name: Sexual differentiation protein ste4
• Gene Name: ste4
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 264
• Protein Description: Essential for mating and meiosis..
• Protein Sequence: MGDSDDFYWNWNNEAVCNWIEQLGFPHKEAFEDYHILGKDIDLLSSNDLRDMGIESVGHRIDILSAIQSMKKQQKDKLQQENKDQELKNIEESYKKLEEKTEHLSDDNVSLEKRVEYLETENTKLVKTLNSLNSEFLQLLRKIAINVKEGRQLTTENSSDTSSMTHPVQPSPSVLGSFDLEVNDSLTNAEKNRKLNVNLTYNEVLCSMLQRYRIDPNTWMSYDLLINYDDKEHAIPMDVKPLQLFRNLQKRGKSPSFVLSRRSC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
105	Phosphorylation	EEKTEHLSDDNVSLE HHHHHCCCCCCCCHH	44.84	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of STE4_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of STE4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of STE4_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
STE4_SCHPO	ste4	physical	8816472
BYR2_SCHPO	byr2	physical	12171939
BYR2_SCHPO	byr2	physical	15364564
BYR2_SCHPO	byr2	physical	8816472
BYR2_SCHPO	byr2	genetic	8816472
BYR1_SCHPO	byr1	genetic	8816472
RAS_SCHPO	ras1	genetic	8816472
BYR2_SCHPO	byr2	genetic	9315645
BYR2_SCHPO	byr2	physical	23695164
BYR2_SCHPO	byr2	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.