UniProt ID | SDU1_SCHPO | |
---|---|---|
UniProt AC | Q8X1T0 | |
Protein Name | DeSI-like protein sdu1 | |
Gene Name | sdu1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 201 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Has a role in meiosis.. | |
Protein Sequence | MKVYINVYDLMPDSPVNKLAWTLGLGIYHTGLVLEGKEYAFGAHEIPGSTGVFATMPRPPLEGCRWRCSIALPNCTLPKPDVDRILIRLSQEFTGLSYSLLERNCNHFTNAAAIELTGSPIPSFLNRISRIGLAFPTITNALLQHGQKNTSDVDDSSDSSSDVDEETLIVSKSKKAHKDIPKFSAPPPSADLNNLITDSLP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
159 | Phosphorylation | DVDDSSDSSSDVDEE CCCCCCCCCCCCCHH | 25720772 | ||
160 | Phosphorylation | VDDSSDSSSDVDEET CCCCCCCCCCCCHHH | 25720772 | ||
161 | Phosphorylation | DDSSDSSSDVDEETL CCCCCCCCCCCHHHE | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SDU1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SDU1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SDU1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EXO1_SCHPO | exo1 | genetic | 22681890 | |
YOI9_SCHPO | SPBC1778.09 | genetic | 22681890 | |
YGVA_SCHPO | def1 | genetic | 22681890 | |
PFL9_SCHPO | pfl9 | genetic | 22681890 | |
TOM70_SCHPO | tom70 | genetic | 22681890 | |
RHP9_SCHPO | crb2 | genetic | 22681890 | |
EMC1_SCHPO | emc1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...