UniProt ID | YBOH_SCHPO | |
---|---|---|
UniProt AC | O43015 | |
Protein Name | Probable secreted beta-glucosidase C2G2.17c | |
Gene Name | SPBC2G2.17c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 319 | |
Subcellular Localization | Secreted . | |
Protein Description | Cell surface beta-glucosidase involved in cell wall biogenesis.. | |
Protein Sequence | MLFNNFLCFAVSAIPLVSAMPLGNAPYHHHHHAGLNASNITVGVNVTNTTAFSKRDGGFPDGVYDCSSFPDDQNGVVRLDYLGFGGWSGVQKNDGKYGTASTCQDNTYCSYACKPGMSKTQWPSEQPDNGVSVGGLYCKNGKLYLTQKDNSNLCEDGKGTAYVKNTLSSNVAICRTDYPGTENMNIPTNIDGGSKQPLSDVDEDSYYNWGGKKTSAQYYVNKSGRSAEDVCVWGNEGDDYGNWAPMNFGSGYTDGKTWLSMSFNPLSSAKLDYNIRIKSDGGSLSGDCYYEDGSFHGSTADSSGCTVSVTGGNAYFELY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | N-linked_Glycosylation | HHHHAGLNASNITVG CCCCCCCCCCCEEEE | 40.17 | - | |
39 | N-linked_Glycosylation | HAGLNASNITVGVNV CCCCCCCCEEEEEEE | 31.38 | - | |
45 | N-linked_Glycosylation | SNITVGVNVTNTTAF CCEEEEEEEECCCCC | 29.03 | - | |
48 | N-linked_Glycosylation | TVGVNVTNTTAFSKR EEEEEEECCCCCCCC | 31.02 | - | |
221 | N-linked_Glycosylation | TSAQYYVNKSGRSAE CEEEEEECCCCCCCC | 19.36 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YBOH_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YBOH_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YBOH_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BQT4_SCHPO | bqt4 | genetic | 22681890 | |
PYP1_SCHPO | pyp1 | genetic | 22681890 | |
CTBL1_SCHPO | SPAC1952.06c | genetic | 22681890 | |
ARGJ_SCHPO | SPBC1271.14 | genetic | 22681890 | |
GBB_SCHPO | git5 | genetic | 22681890 | |
GPA2_SCHPO | gpa2 | genetic | 22681890 | |
ATP14_SCHPO | atp14 | genetic | 22681890 | |
PPME1_SCHPO | SPBP4H10.17c | genetic | 22681890 | |
YOFG_SCHPO | SPBP4H10.16c | genetic | 22681890 | |
FFT3_SCHPO | fft3 | genetic | 22681890 | |
PPK9_SCHPO | ppk9 | genetic | 22681890 | |
YBN5_SCHPO | SPBC8E4.05c | genetic | 22681890 | |
YKEE_SCHPO | SPAC1805.14 | genetic | 22681890 | |
TCG1_SCHPO | tcg1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...