UniProt ID | MUG89_SCHPO | |
---|---|---|
UniProt AC | Q1MTQ5 | |
Protein Name | Meiotically up-regulated gene 89 protein | |
Gene Name | mug89 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 396 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Has a role in meiosis.. | |
Protein Sequence | MPEALNENVSDTASNGPVAKTRAPPNTSFRQQRIKSWQPLLTPKIVLPLFFVLGIIFGPLGGGLLYASSIVQELVVDYTDCETLASYDEFSAVPSKKYTASFDQSGTIGFDKESTYWKLEKILDKDLDMDVNYCIIRFTVPSVLKAPIFIYYRLTNFFQNHRRYAKSVDEKQLQGVALTADEVKGGNCFPLEVNEDDKPYYPCGLIANSLFNDTFSSLRLLDDNSVYTFSTKNIAWASDKRRFLKTNYSPDDVAPPPNWVLRYPDGYTESNMPDLSTMENLQVWMRTAGLPTFSKLAMRNDNDDIFPGTYEIKIGLFFPVKSFDGTKSLVLTTRSVLGGKNPFLGIAYIVVSAVCVVLGTVFTLRHFIRPRKLADHRYLNWDSEENNLAPHLSDRP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | EALNENVSDTASNGP HHHHCCCCCCCCCCC | 40.60 | 21712547 | |
12 | Phosphorylation | LNENVSDTASNGPVA HHCCCCCCCCCCCCC | 25.20 | 28889911 | |
14 | Phosphorylation | ENVSDTASNGPVAKT CCCCCCCCCCCCCCC | 44.40 | 24763107 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MUG89_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MUG89_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MUG89_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CAF1_SCHPO | caf1 | genetic | 18818364 | |
VTS1_SCHPO | SPBC13E7.03c | genetic | 22681890 | |
YM02_SCHPO | SPAC212.02 | genetic | 22681890 | |
SKH1_SCHPO | pek1 | genetic | 22681890 | |
RM01_SCHPO | SPAC1610.02c | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...