dbPTM

MUG89_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MUG89_SCHPO
UniProt AC	Q1MTQ5
Protein Name	Meiotically up-regulated gene 89 protein
Gene Name	mug89
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	396
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein .
Protein Description	Has a role in meiosis..
Protein Sequence	MPEALNENVSDTASNGPVAKTRAPPNTSFRQQRIKSWQPLLTPKIVLPLFFVLGIIFGPLGGGLLYASSIVQELVVDYTDCETLASYDEFSAVPSKKYTASFDQSGTIGFDKESTYWKLEKILDKDLDMDVNYCIIRFTVPSVLKAPIFIYYRLTNFFQNHRRYAKSVDEKQLQGVALTADEVKGGNCFPLEVNEDDKPYYPCGLIANSLFNDTFSSLRLLDDNSVYTFSTKNIAWASDKRRFLKTNYSPDDVAPPPNWVLRYPDGYTESNMPDLSTMENLQVWMRTAGLPTFSKLAMRNDNDDIFPGTYEIKIGLFFPVKSFDGTKSLVLTTRSVLGGKNPFLGIAYIVVSAVCVVLGTVFTLRHFIRPRKLADHRYLNWDSEENNLAPHLSDRP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	EALNENVSDTASNGP HHHHCCCCCCCCCCC	40.60	21712547
12	Phosphorylation	LNENVSDTASNGPVA HHCCCCCCCCCCCCC	25.20	28889911
14	Phosphorylation	ENVSDTASNGPVAKT CCCCCCCCCCCCCCC	44.40	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MUG89_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MUG89_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MUG89_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CAF1_SCHPO	caf1	genetic	18818364
VTS1_SCHPO	SPBC13E7.03c	genetic	22681890
YM02_SCHPO	SPAC212.02	genetic	22681890
SKH1_SCHPO	pek1	genetic	22681890
RM01_SCHPO	SPAC1610.02c	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MUG89_SCHPO

Related Literatures of Post-Translational Modification