PP2A1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PP2A1_SCHPO
• UniProt AC: P23635
• Protein Name: Minor serine/threonine-protein phosphatase PP2A-1 catalytic subunit
• Gene Name: ppa1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 309
• Protein Description: Essential role in cell cycle control. PP2A may be involved in controlling the entry into mitosis, possibly acting as an inhibitor..
• Protein Sequence: MSVSGKIGEVDRWIEQLSRCEPLSEEDVIQMCDLAKEVLSVESNVQSVRCPVTVCGDIHGQFHDLMELFNIGGPSPDTNYLFMGDYVDRGYHSVETVSLLIAFKIRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANVWQYFTDLFDYLPLTALIEDRIFCLHGGLSPSIDTLDHVRILDRVQEVPHEGPICDLLWSDPDDRPGWGISPRGAGYTFGPDIAEAFNHNNGLDLIARAHQLVMEGYNWTTNHNVVTIFSAPNYCYRCGNQAAIMGIDDHINYAFIQYDTAPRKEELHVTRRTPDYFL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
309	Methylation	RRTPDYFL------- CCCCCCCC-------	5.81	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PP2A1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PP2A1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PP2A1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PP2A2_SCHPO	ppa2	genetic	22267499
PTPA2_SCHPO	ypa2	genetic	22267499
ULP2_SCHPO	ulp2	genetic	22681890
TRX2_SCHPO	trx2	genetic	22681890
YCJ5_SCHPO	tap42	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.