UniProt ID | YCJ5_SCHPO | |
---|---|---|
UniProt AC | Q9Y7T1 | |
Protein Name | Uncharacterized protein C63.05 | |
Gene Name | SPCC63.05 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 323 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MESKSLRELWEETEKLKDSSSTDEKTRSEIVEGYEKCLKLVLQLRIFSSNEEVDEIKTSELRYLMIDYELAKCVEQWTKGDRLKAVQYAKTHYETFLSICDDYGLKPMQDEKPKTEADTRTLKIARYRMRQNLEKELKALSKDSETNEEQERKFWLTKLQIAVEDTLDSLPHIEMEIDLLKRAQAELMKSEDSPEKDEETLRREERKQKEGSSWRLDLNTRDKILDKNNRPLQPFTIVSDRNETRKNVFGFGYNLPTMTVDEYLDEEMKRGNIISQKDNPPKSDSDDEDDYEKLDAKTMKDRYWDEFKEANPRGSGNTMVNRG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
193 | Phosphorylation | ELMKSEDSPEKDEET HHHCCCCCCCHHHHH | 30.79 | 29996109 | |
283 | Phosphorylation | QKDNPPKSDSDDEDD CCCCCCCCCCCCHHH | 48.39 | 24763107 | |
285 | Phosphorylation | DNPPKSDSDDEDDYE CCCCCCCCCCHHHHH | 54.79 | 24763107 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YCJ5_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YCJ5_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YCJ5_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
REC11_SCHPO | rec11 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...