YCJ5_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YCJ5_SCHPO
• UniProt AC: Q9Y7T1
• Protein Name: Uncharacterized protein C63.05
• Gene Name: SPCC63.05
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 323
• Protein Sequence: MESKSLRELWEETEKLKDSSSTDEKTRSEIVEGYEKCLKLVLQLRIFSSNEEVDEIKTSELRYLMIDYELAKCVEQWTKGDRLKAVQYAKTHYETFLSICDDYGLKPMQDEKPKTEADTRTLKIARYRMRQNLEKELKALSKDSETNEEQERKFWLTKLQIAVEDTLDSLPHIEMEIDLLKRAQAELMKSEDSPEKDEETLRREERKQKEGSSWRLDLNTRDKILDKNNRPLQPFTIVSDRNETRKNVFGFGYNLPTMTVDEYLDEEMKRGNIISQKDNPPKSDSDDEDDYEKLDAKTMKDRYWDEFKEANPRGSGNTMVNRG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
193	Phosphorylation	ELMKSEDSPEKDEET HHHCCCCCCCHHHHH	30.79	29996109
283	Phosphorylation	QKDNPPKSDSDDEDD CCCCCCCCCCCCHHH	48.39	24763107
285	Phosphorylation	DNPPKSDSDDEDDYE CCCCCCCCCCHHHHH	54.79	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YCJ5_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YCJ5_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YCJ5_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
REC11_SCHPO	rec11	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.