UniProt ID | EI2BA_SCHPO | |
---|---|---|
UniProt AC | Q9USP0 | |
Protein Name | Translation initiation factor eIF-2B subunit alpha | |
Gene Name | tif221 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 341 | |
Subcellular Localization | ||
Protein Description | Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.. | |
Protein Sequence | MVESDSSGIVRHSQGEFDIVQVYKKFLQDDPEITMPVAAIEALVQLLSRSQAKTISEFMDILQNGSNTLKEGVQNNISLSAGCDIFQRFVTRSLHDVGDFEQCKRHLVENGKLFIQRARACRQRIAHLGYPLIRDGSVILTHGFSRGVAAVLLAAAKRHVRFKVFVTESRPSGSGCLMTRTLKNACIPTCMVLDSAVSFTMNRVDLVLVGAEGVVENGGLINQIGTFQLAVFAKHAHKPFYAVAESHKFVRMFPLSQYDIPFSRPILEFDDPSPETVHPEPEPIPTPSDAIHNELIMNEEQIRNNPTLDVTPPEFVSGLITDLGIIDSKSGVSEELIKLYL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MVESDSSGIVR ----CCCCCCCCCCC | 31.23 | 24763107 | |
6 | Phosphorylation | --MVESDSSGIVRHS --CCCCCCCCCCCCC | 39.48 | 24763107 | |
7 | Phosphorylation | -MVESDSSGIVRHSQ -CCCCCCCCCCCCCC | 37.21 | 21712547 | |
13 | Phosphorylation | SSGIVRHSQGEFDIV CCCCCCCCCCCEEEH | 29.35 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EI2BA_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EI2BA_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EI2BA_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PROB_SCHPO | SPAC17H9.13c | genetic | 22681890 | |
PDX1_SCHPO | snz1 | genetic | 22681890 | |
ARF6_SCHPO | arf6 | genetic | 22681890 | |
AATC_SCHPO | SPAC10F6.13c | genetic | 22681890 | |
PNG1_SCHPO | SPBC1709.14 | genetic | 22681890 | |
YFM8_SCHPO | SPAC222.08c | genetic | 22681890 | |
AATM_SCHPO | SPBC725.01 | genetic | 22681890 | |
CYSK_SCHPO | cys11 | genetic | 22681890 | |
GYP51_SCHPO | gyp51 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...